Tupaia chinensis (Chinese tree shrew): 102494820 Help Entry 102494820         CDS       T02978                                  Symbol GNG3 Name (RefSeq) G protein subunit gamma 3   KO K04540   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04014   Ras signaling pathway tup04062   Chemokine signaling pathway tup04081   Hormone signaling tup04082   Neuroactive ligand signaling tup04151   PI3K-Akt signaling pathway tup04371   Apelin signaling pathway tup04713   Circadian entrainment tup04723   Retrograde endocannabinoid signaling tup04724   Glutamatergic synapse tup04725   Cholinergic synapse tup04726   Serotonergic synapse tup04727   GABAergic synapse tup04728   Dopaminergic synapse tup04926   Relaxin signaling pathway tup05032   Morphine addiction tup05034   Alcoholism tup05163   Human cytomegalovirus infection tup05167   Kaposi sarcoma-associated herpesvirus infection tup05170   Human immunodeficiency virus 1 infection tup05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102494820 (GNG3)    04371 Apelin signaling pathway     102494820 (GNG3)    04151 PI3K-Akt signaling pathway     102494820 (GNG3)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     102494820 (GNG3)    04081 Hormone signaling     102494820 (GNG3)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     102494820 (GNG3)   09152 Endocrine system    04926 Relaxin signaling pathway     102494820 (GNG3)   09156 Nervous system    04724 Glutamatergic synapse     102494820 (GNG3)    04727 GABAergic synapse     102494820 (GNG3)    04725 Cholinergic synapse     102494820 (GNG3)    04728 Dopaminergic synapse     102494820 (GNG3)    04726 Serotonergic synapse     102494820 (GNG3)    04723 Retrograde endocannabinoid signaling     102494820 (GNG3)   09159 Environmental adaptation    04713 Circadian entrainment     102494820 (GNG3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102494820 (GNG3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102494820 (GNG3)    05163 Human cytomegalovirus infection     102494820 (GNG3)    05167 Kaposi sarcoma-associated herpesvirus infection     102494820 (GNG3)   09165 Substance dependence    05032 Morphine addiction     102494820 (GNG3)    05034 Alcoholism     102494820 (GNG3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:tup04031]     102494820 (GNG3) GTP-binding proteins [BR:tup04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     102494820 (GNG3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma GPR158_179_EC Motif Other DBs NCBI-GeneID:  102494820 NCBI-ProteinID:  XP_006156637 UniProt:  L9JNG9 LinkDB All DBs Position Un AA seq 75 aa AA seqDB search MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMSYCDAHACEDPLITPVPT SENPFREKKFFCALL NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgaaaggggaaacccctgtgaacagcactatgagtattgggcaagcgcgcaagatggtg gaacagcttaagattgaagccagcttgtgccggataaaggtgtccaaggcagcagcagac ctgatgagttactgtgacgcccacgcctgtgaggatcccctcatcaccccggtgcccact tcggaaaacccctttcgggagaagaaattcttctgtgccctcctctga

DBGET integrated database retrieval system