Tupaia chinensis (Chinese tree shrew): 102495211 Help Entry 102495211         CDS       T02978                                  Symbol CCL24 Name (RefSeq) C-C motif chemokine ligand 24   KO K21097   C-C motif chemokine 24 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04060   Cytokine-cytokine receptor interaction tup04061   Viral protein interaction with cytokine and cytokine receptor tup04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102495211 (CCL24)    04061 Viral protein interaction with cytokine and cytokine receptor     102495211 (CCL24)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     102495211 (CCL24)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102495211 (CCL24) Cytokines and neuropeptides [BR:tup04052]  Cytokines   Chemokines    102495211 (CCL24) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  102495211 NCBI-ProteinID:  XP_006155692 UniProt:  L9K0W1 LinkDB All DBs Position Un AA seq 119 aa AA seqDB search MAGPTTIAASLLLLALCAHYLALTGSVIIPSSCCLNFISKKFPENRVVSYQLSNRSVCPQ AGVIFTTRKGQKFCGDPEQQWVQKYMKNLDAKQKKASSGVRAKGTKVPLRKNPGKGNTL NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcaggccccaccaccatcgcagccagcctattgctcctggccctctgtgctcactac cttgccctcacaggctctgtgatcatcccctcttcctgctgcttgaactttatctccaag aagtttcctgagaaccgagtggtaagctaccagctgtccaacaggagcgtctgccctcag gcaggggtcatcttcaccaccaggaagggccagaagttctgtggtgaccccgagcagcag tgggttcagaagtacatgaagaacctggatgccaagcagaagaaggcttcctctggggtc agggcaaagggtaccaaggtccctctcaggaagaaccctggcaaaggcaataccctgtaa

DBGET integrated database retrieval system