Tupaia chinensis (Chinese tree shrew): 102495993 Help Entry 102495993         CDS       T02978                                  Symbol IL5 Name (RefSeq) interleukin 5   KO K05428   interleukin 5 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04060   Cytokine-cytokine receptor interaction tup04630   JAK-STAT signaling pathway tup04640   Hematopoietic cell lineage tup04657   IL-17 signaling pathway tup04658   Th1 and Th2 cell differentiation tup04660   T cell receptor signaling pathway tup04664   Fc epsilon RI signaling pathway tup04672   Intestinal immune network for IgA production tup05200   Pathways in cancer tup05310   Asthma tup05320   Autoimmune thyroid disease tup05321   Inflammatory bowel disease tup05330   Allograft rejection Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102495993 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102495993 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102495993 (IL5)    04660 T cell receptor signaling pathway     102495993 (IL5)    04658 Th1 and Th2 cell differentiation     102495993 (IL5)    04657 IL-17 signaling pathway     102495993 (IL5)    04664 Fc epsilon RI signaling pathway     102495993 (IL5)    04672 Intestinal immune network for IgA production     102495993 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102495993 (IL5)   09163 Immune disease    05310 Asthma     102495993 (IL5)    05320 Autoimmune thyroid disease     102495993 (IL5)    05321 Inflammatory bowel disease     102495993 (IL5)    05330 Allograft rejection     102495993 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102495993 (IL5)    00536 Glycosaminoglycan binding proteins [BR:tup00536]     102495993 (IL5) Cytokines and neuropeptides [BR:tup04052]  Cytokines   Interleukins    102495993 (IL5) Glycosaminoglycan binding proteins [BR:tup00536]  Heparan sulfate / Heparin   Cytokines    102495993 (IL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL5 DUF999 Motif Other DBs NCBI-GeneID:  102495993 NCBI-ProteinID:  XP_006166942 LinkDB All DBs Position Un AA seq 134 aa AA seqDB search MRMLLQLGFLALGVAYIHGFAIGSSMSTVVAETLALLSTHRTLLTGNESLRIPVPAHKNH QLCTEEIFQGIDTLKNQTVQGDAVEKLFRNLSLLKNYIDDQKKKCGEERRRVKQFLEYLQ EFLGVINTEWTMES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagaatgcttctgcagttgggttttctggctcttggagttgcctacatccatgggttt gctataggcagttccatgagtacagtggtggcagagaccctggctctactctcgacccat cgaactctgctgacaggcaatgagagcctgaggattcctgttcctgcgcataaaaatcac caactatgcactgaagaaatctttcagggaatagacacactgaagaatcaaaccgtacaa ggagacgctgtggaaaaactattccgaaacttatctttgttaaaaaattacattgacgac caaaaaaaaaagtgcggagaagaaagacggagagtaaagcaattcctagaatacttacaa gaatttcttggggtgataaacactgagtggacaatggagagttga

DBGET integrated database retrieval system