KEGG   Tupaia chinensis (Chinese tree shrew): 102496453
Entry
102496453         CDS       T02978                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup01524  Platinum drug resistance
tup04010  MAPK signaling pathway
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04066  HIF-1 signaling pathway
tup04068  FoxO signaling pathway
tup04071  Sphingolipid signaling pathway
tup04072  Phospholipase D signaling pathway
tup04114  Oocyte meiosis
tup04140  Autophagy - animal
tup04148  Efferocytosis
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04210  Apoptosis
tup04218  Cellular senescence
tup04261  Adrenergic signaling in cardiomyocytes
tup04270  Vascular smooth muscle contraction
tup04350  TGF-beta signaling pathway
tup04360  Axon guidance
tup04370  VEGF signaling pathway
tup04371  Apelin signaling pathway
tup04380  Osteoclast differentiation
tup04510  Focal adhesion
tup04517  IgSF CAM signaling
tup04520  Adherens junction
tup04540  Gap junction
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04611  Platelet activation
tup04613  Neutrophil extracellular trap formation
tup04620  Toll-like receptor signaling pathway
tup04621  NOD-like receptor signaling pathway
tup04625  C-type lectin receptor signaling pathway
tup04650  Natural killer cell mediated cytotoxicity
tup04657  IL-17 signaling pathway
tup04658  Th1 and Th2 cell differentiation
tup04659  Th17 cell differentiation
tup04660  T cell receptor signaling pathway
tup04662  B cell receptor signaling pathway
tup04664  Fc epsilon RI signaling pathway
tup04666  Fc gamma R-mediated phagocytosis
tup04668  TNF signaling pathway
tup04713  Circadian entrainment
tup04720  Long-term potentiation
tup04722  Neurotrophin signaling pathway
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04726  Serotonergic synapse
tup04730  Long-term depression
tup04810  Regulation of actin cytoskeleton
tup04910  Insulin signaling pathway
tup04912  GnRH signaling pathway
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04916  Melanogenesis
tup04917  Prolactin signaling pathway
tup04919  Thyroid hormone signaling pathway
tup04921  Oxytocin signaling pathway
tup04926  Relaxin signaling pathway
tup04928  Parathyroid hormone synthesis, secretion and action
tup04929  GnRH secretion
tup04930  Type II diabetes mellitus
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup04960  Aldosterone-regulated sodium reabsorption
tup05010  Alzheimer disease
tup05020  Prion disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05034  Alcoholism
tup05132  Salmonella infection
tup05133  Pertussis
tup05135  Yersinia infection
tup05140  Leishmaniasis
tup05142  Chagas disease
tup05145  Toxoplasmosis
tup05152  Tuberculosis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05170  Human immunodeficiency virus 1 infection
tup05171  Coronavirus disease - COVID-19
tup05200  Pathways in cancer
tup05203  Viral carcinogenesis
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05207  Chemical carcinogenesis - receptor activation
tup05208  Chemical carcinogenesis - reactive oxygen species
tup05210  Colorectal cancer
tup05211  Renal cell carcinoma
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05216  Thyroid cancer
tup05218  Melanoma
tup05219  Bladder cancer
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05230  Central carbon metabolism in cancer
tup05231  Choline metabolism in cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tup05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102496453 (MAPK1)
   04012 ErbB signaling pathway
    102496453 (MAPK1)
   04014 Ras signaling pathway
    102496453 (MAPK1)
   04015 Rap1 signaling pathway
    102496453 (MAPK1)
   04350 TGF-beta signaling pathway
    102496453 (MAPK1)
   04370 VEGF signaling pathway
    102496453 (MAPK1)
   04371 Apelin signaling pathway
    102496453 (MAPK1)
   04668 TNF signaling pathway
    102496453 (MAPK1)
   04066 HIF-1 signaling pathway
    102496453 (MAPK1)
   04068 FoxO signaling pathway
    102496453 (MAPK1)
   04072 Phospholipase D signaling pathway
    102496453 (MAPK1)
   04071 Sphingolipid signaling pathway
    102496453 (MAPK1)
   04024 cAMP signaling pathway
    102496453 (MAPK1)
   04022 cGMP-PKG signaling pathway
    102496453 (MAPK1)
   04151 PI3K-Akt signaling pathway
    102496453 (MAPK1)
   04150 mTOR signaling pathway
    102496453 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    102496453 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102496453 (MAPK1)
   04148 Efferocytosis
    102496453 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102496453 (MAPK1)
   04210 Apoptosis
    102496453 (MAPK1)
   04218 Cellular senescence
    102496453 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102496453 (MAPK1)
   04520 Adherens junction
    102496453 (MAPK1)
   04540 Gap junction
    102496453 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102496453 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102496453 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102496453 (MAPK1)
   04613 Neutrophil extracellular trap formation
    102496453 (MAPK1)
   04620 Toll-like receptor signaling pathway
    102496453 (MAPK1)
   04621 NOD-like receptor signaling pathway
    102496453 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    102496453 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    102496453 (MAPK1)
   04660 T cell receptor signaling pathway
    102496453 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    102496453 (MAPK1)
   04659 Th17 cell differentiation
    102496453 (MAPK1)
   04657 IL-17 signaling pathway
    102496453 (MAPK1)
   04662 B cell receptor signaling pathway
    102496453 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    102496453 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    102496453 (MAPK1)
   04062 Chemokine signaling pathway
    102496453 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102496453 (MAPK1)
   04929 GnRH secretion
    102496453 (MAPK1)
   04912 GnRH signaling pathway
    102496453 (MAPK1)
   04915 Estrogen signaling pathway
    102496453 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    102496453 (MAPK1)
   04917 Prolactin signaling pathway
    102496453 (MAPK1)
   04921 Oxytocin signaling pathway
    102496453 (MAPK1)
   04926 Relaxin signaling pathway
    102496453 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    102496453 (MAPK1)
   04919 Thyroid hormone signaling pathway
    102496453 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    102496453 (MAPK1)
   04916 Melanogenesis
    102496453 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102496453 (MAPK1)
   04270 Vascular smooth muscle contraction
    102496453 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102496453 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102496453 (MAPK1)
   04725 Cholinergic synapse
    102496453 (MAPK1)
   04726 Serotonergic synapse
    102496453 (MAPK1)
   04720 Long-term potentiation
    102496453 (MAPK1)
   04730 Long-term depression
    102496453 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    102496453 (MAPK1)
   04722 Neurotrophin signaling pathway
    102496453 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    102496453 (MAPK1)
   04380 Osteoclast differentiation
    102496453 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102496453 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102496453 (MAPK1)
   05206 MicroRNAs in cancer
    102496453 (MAPK1)
   05205 Proteoglycans in cancer
    102496453 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    102496453 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    102496453 (MAPK1)
   05203 Viral carcinogenesis
    102496453 (MAPK1)
   05230 Central carbon metabolism in cancer
    102496453 (MAPK1)
   05231 Choline metabolism in cancer
    102496453 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102496453 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102496453 (MAPK1)
   05212 Pancreatic cancer
    102496453 (MAPK1)
   05225 Hepatocellular carcinoma
    102496453 (MAPK1)
   05226 Gastric cancer
    102496453 (MAPK1)
   05214 Glioma
    102496453 (MAPK1)
   05216 Thyroid cancer
    102496453 (MAPK1)
   05221 Acute myeloid leukemia
    102496453 (MAPK1)
   05220 Chronic myeloid leukemia
    102496453 (MAPK1)
   05218 Melanoma
    102496453 (MAPK1)
   05211 Renal cell carcinoma
    102496453 (MAPK1)
   05219 Bladder cancer
    102496453 (MAPK1)
   05215 Prostate cancer
    102496453 (MAPK1)
   05213 Endometrial cancer
    102496453 (MAPK1)
   05224 Breast cancer
    102496453 (MAPK1)
   05223 Non-small cell lung cancer
    102496453 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102496453 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    102496453 (MAPK1)
   05161 Hepatitis B
    102496453 (MAPK1)
   05160 Hepatitis C
    102496453 (MAPK1)
   05171 Coronavirus disease - COVID-19
    102496453 (MAPK1)
   05164 Influenza A
    102496453 (MAPK1)
   05163 Human cytomegalovirus infection
    102496453 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102496453 (MAPK1)
   05165 Human papillomavirus infection
    102496453 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102496453 (MAPK1)
   05135 Yersinia infection
    102496453 (MAPK1)
   05133 Pertussis
    102496453 (MAPK1)
   05152 Tuberculosis
    102496453 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102496453 (MAPK1)
   05140 Leishmaniasis
    102496453 (MAPK1)
   05142 Chagas disease
    102496453 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102496453 (MAPK1)
   05020 Prion disease
    102496453 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    102496453 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    102496453 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102496453 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102496453 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102496453 (MAPK1)
   04934 Cushing syndrome
    102496453 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102496453 (MAPK1)
   01524 Platinum drug resistance
    102496453 (MAPK1)
   01522 Endocrine resistance
    102496453 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tup01001]
    102496453 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102496453 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tup04147]
    102496453 (MAPK1)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102496453 (MAPK1)
Protein kinases [BR:tup01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102496453 (MAPK1)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     102496453 (MAPK1)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102496453 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 102496453
NCBI-ProteinID: XP_014442327
LinkDB
Position
Un
AA seq 348 aa
MVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREI
KILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQ
ILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRW
YRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDL
NCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPY
LEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggtccgcgggcaggtgttcgacgtggggccgcgctacaccaacctctcgtacatcggc
gagggcgcctacggcatggtgtgctctgcttatgataatgtcaacaaagtccgagtagca
atcaagaaaatcagtcccttcgagcaccagacctactgccagcggaccctgagggagata
aaaatcttactgcgcttcagacacgagaacatcatcgggatcaatgacattatccgagcg
ccgaccatcgagcagatgaaagatgtatatatagtacaggatctcatggaaacagatctt
tacaagctcttgaagacacaacacctcagcaacgaccatatctgctattttctttatcag
atcctcagagggttaaaatatatccattcagctaacgttctgcaccgcgacctcaagcct
tccaacctgctgctcaacaccacctgcgatctcaagatctgcgactttggcctggcccgt
gttgcagacccagaccatgatcacacagggttcctgacagagtacgtagccacacgttgg
tacagggctccggaaatcatgttgaattccaagggctacaccaagtccatcgacatctgg
tccgtgggctgcatcctggcagagatgctctcgaacagacccatcttccccgggaagcac
tacctcgaccagctgaaccacattctcggtatccttggatccccatcacaggaagacctg
aattgtattataaacttaaaagctagaaactatttgctctctcttccacacaaaaataag
gttccatggaacaggctgtttccaaacgccgactccaaagctctggacttactggacaaa
atgttgacgttcaaccctcacaagaggattgaagtggaacaggctctggcccacccgtat
ctggagcagtattatgacccaagtgacgagcccgtcgctgaagcaccattcaagttcgac
atggaattggatgacttgcctaaggagaagctgaaagagctcatctttgaagagaccgct
agattccagccgggatacagatcttaa

DBGET integrated database retrieval system