Tupaia chinensis (Chinese tree shrew): 102496631 Help Entry 102496631         CDS       T02978                                  Name (RefSeq) uncharacterized LOC102496631   KO K16598   C-C motif chemokine 27 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04060   Cytokine-cytokine receptor interaction tup04061   Viral protein interaction with cytokine and cytokine receptor tup04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102496631    04061 Viral protein interaction with cytokine and cytokine receptor     102496631  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     102496631  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102496631 Cytokines and neuropeptides [BR:tup04052]  Cytokines   Chemokines    102496631 BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  102496631 NCBI-ProteinID:  XP_006143208 UniProt:  L9L5M5 LinkDB All DBs Position Un AA seq 87 aa AA seqDB search MSGLRRYEVALEAEEEIYWGCFYFFPWLRMWRRERSSAHPREQKLEPLRGLMSCLSSGLG PAPQRTGRGLPRRAPASAGQPAGALKI NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtcgggattgaggagatacgaggtggcgctggaggcggaggaggagatctactggggc tgtttctactttttcccctggctgcgcatgtggcggagggagcggagctcggcgcacccc cgggagcagaagctggagcctctgcggggcctgatgagctgtctgtcgagcggcctgggc cctgctccccagcgcacgggtcgtggccttccccgccgcgcccccgcctccgctggccag ccagccggtgcattaaagatttaa

DBGET integrated database retrieval system