Tupaia chinensis (Chinese tree shrew): 102497371 Help Entry 102497371         CDS       T02978                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism tup  Tupaia chinensis (Chinese tree shrew) Brite KEGG Orthology (KO) [BR:tup00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:tup03041]     102497371   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102497371 Spliceosome [BR:tup03041]  Complex B   Other components    Complex B specific factors     102497371 Cytokines and neuropeptides [BR:tup04052]  Neuropeptides   Unclassified    102497371 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  102497371 NCBI-ProteinID:  XP_014437734 LinkDB All DBs Position Un AA seq 73 aa AA seqDB search MIKVVGNDHLGKTVCVKCNTDDTIGDLKKLIAAQTVTCWNKIVLKKWYTIFKDHASLGDY EVHDGMNPELDYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcaaggtggttggcaatgaccatctggggaagacggtctgcgtgaaatgtaacaca gatgacaccatcggggaccttaagaagctgattgcagcccagactgtcacctgttggaac aagatcgtgctgaaaaagtggtacacgattttcaaggatcatgcatctctgggggattat gaagtccatgatgggatgaacccggaacttgattatcagtag

DBGET integrated database retrieval system