Tupaia chinensis (Chinese tree shrew): 102497568 Help Entry 102497568         CDS       T02978                                  Symbol LTA Name (RefSeq) lymphotoxin alpha   KO K05468   lymphotoxin alpha (TNF superfamily, member 1) Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04060   Cytokine-cytokine receptor interaction tup04061   Viral protein interaction with cytokine and cytokine receptor tup04064   NF-kappa B signaling pathway tup04668   TNF signaling pathway tup04940   Type I diabetes mellitus tup05166   Human T-cell leukemia virus 1 infection tup05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102497568 (LTA)    04668 TNF signaling pathway     102497568 (LTA)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102497568 (LTA)    04061 Viral protein interaction with cytokine and cytokine receptor     102497568 (LTA)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102497568 (LTA)    05168 Herpes simplex virus 1 infection     102497568 (LTA)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102497568 (LTA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102497568 (LTA) Cytokines and neuropeptides [BR:tup04052]  Cytokines   Tumor necrosis fators    102497568 (LTA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  102497568 NCBI-ProteinID:  XP_006154313 LinkDB All DBs Position Un AA seq 205 aa AA seqDB search MTPSGRLCLGRVHSAPLLLLLQGLLLALPPGAQALPGVDLSPSAAQAAHQHPQKHLAPST LKPAAHLVGDPSVQNTLRWRASTDRAFLRHGFALTNNSLLVPSSGLYFVYSQVVFSGEGC SPQAAPTPLYLAHGVQLFSSQYPHHVPLLSAQKSVCPGPQGPWVRSVYQGAVFLLTRGDQ LSTHTVGTSHLLLSPSSVFFGAFAL NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgacaccatctggacgtctctgcctcgggagggtgcacagcgcccccctcctcctcctg cttcaggggctgctgttggccctgccgcccggggcccaggcgctccctggggttgacctt tcaccctcagcggcccaggctgcccaccagcacccccagaagcacttggcccccagcacc ctcaagcctgctgctcacctcgttggagaccccagcgtgcagaacacgctgcgctggcga gcgagcaccgaccgcgccttcctgcgccacggcttcgcgctgaccaacaactccctgctg gtgcccagcagcggcctctacttcgtctactcgcaggtggtcttctccggggaaggctgc tccccacaggccgcccccaccccgctctacctggcgcacggggtgcagctcttctcctcc cagtacccgcaccacgtgccgctcctcagcgcccagaagtccgtctgcccagggccgcag ggaccgtgggtgcgctcggtgtaccagggggccgtgttcctgctcactcggggagaccag ctgtccactcacacagtcggcacctcccacctgctcctgagccccagcagcgtctttttt ggagcttttgctctgtag

DBGET integrated database retrieval system