Tupaia chinensis (Chinese tree shrew): 102500824 Help Entry 102500824         CDS       T02978                                  Symbol FGF16 Name (RefSeq) fibroblast growth factor 16   KO K04358   fibroblast growth factor Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04010   MAPK signaling pathway tup04014   Ras signaling pathway tup04015   Rap1 signaling pathway tup04020   Calcium signaling pathway tup04151   PI3K-Akt signaling pathway tup04810   Regulation of actin cytoskeleton tup05200   Pathways in cancer tup05207   Chemical carcinogenesis - receptor activation tup05218   Melanoma tup05224   Breast cancer tup05226   Gastric cancer Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102500824 (FGF16)    04014 Ras signaling pathway     102500824 (FGF16)    04015 Rap1 signaling pathway     102500824 (FGF16)    04020 Calcium signaling pathway     102500824 (FGF16)    04151 PI3K-Akt signaling pathway     102500824 (FGF16)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102500824 (FGF16)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102500824 (FGF16)    05207 Chemical carcinogenesis - receptor activation     102500824 (FGF16)   09162 Cancer: specific types    05226 Gastric cancer     102500824 (FGF16)    05218 Melanoma     102500824 (FGF16)    05224 Breast cancer     102500824 (FGF16)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102500824 (FGF16)    00536 Glycosaminoglycan binding proteins [BR:tup00536]     102500824 (FGF16) Cytokines and neuropeptides [BR:tup04052]  Cytokines   Growth factors (RTK binding)    102500824 (FGF16) Glycosaminoglycan binding proteins [BR:tup00536]  Heparan sulfate / Heparin   Growth factors/receptors    102500824 (FGF16) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  102500824 NCBI-ProteinID:  XP_006148841 LinkDB All DBs Position Un AA seq 154 aa AA seqDB search MEQARAAAQVFVRSGSYLARCQSSTVLALEESCSLFCLGILEFISLAVGLISIRGVDSGL YLGMNERGELYGSKKLTHECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPRE GCRTKRHQKFTHFLPRPVDPSKLPSLSRDLFRYR NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atggagcaggctcgtgcagctgctcaggtttttgtgagatctggttcttatttggcaaga tgccaaagcagcactgtcttggccctggaggaatcgtgttcacttttttgcctaggcatc ttggagtttatcagtttggctgtggggctgatcagcatccggggagtagactctggcctg tacctaggaatgaacgaacgaggagaactctatgggtcgaagaaactcacacatgaatgt gttttccgggaacaatttgaagaaaactggtacaacacctatgcatccaccttgtacaaa cactcggattcggagagacagtattatgtggccctgaataaagatggctcaccccgggag ggatgcaggactaaacgacatcagaaattcactcattttttacccaggccagtagatcct tctaagttgccctccctgtccagagacctcttccgctataggtaa

DBGET integrated database retrieval system