Tupaia chinensis (Chinese tree shrew): 102500875 Help Entry 102500875         CDS       T02978                                  Symbol SUMO3 Name (RefSeq) small ubiquitin-like modifier 3   KO K12160   small ubiquitin-related modifier Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup03013   Nucleocytoplasmic transport tup05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tup00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     102500875 (SUMO3)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102500875 (SUMO3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tup04121]     102500875 (SUMO3)    03029 Mitochondrial biogenesis [BR:tup03029]     102500875 (SUMO3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tup04812]     102500875 (SUMO3) Ubiquitin system [BR:tup04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    102500875 (SUMO3) Mitochondrial biogenesis [BR:tup03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     102500875 (SUMO3) Cytoskeleton proteins [BR:tup04812]  Eukaryotic cytoskeleton proteins   Septins    Septin associated proteins     102500875 (SUMO3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Rad60-SLD ubiquitin Motif Other DBs NCBI-GeneID:  102500875 NCBI-ProteinID:  XP_014440016 LinkDB All DBs Position Un AA seq 133 aa AA seqDB search MGRAAAESVTGRAAPSLPAALCRLRRHAAMSEEKPKEGVKTENDHINLKVAGQDGSVVQF KIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTG GARETSCLLVHSP NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atggggagagcggcggccgagagcgtgactggccgcgccgcgccgagccttcccgccgcc ctttgccgtctccgccgccacgcagccatgtccgaggagaagcccaaggagggagtgaag acagagaacgaccacatcaacctgaaggtggccgggcaggacggctctgtggtgcaattt aagatcaagaggcacaccccattgagcaagctgatgaaggcctactgcgagaggcagggt ttatcgatgagacaaattagattcaggtttgatgggcaaccaattaatgaaacagacact ccagcacagctggagatggaggatgaggacaccattgacgtcttccagcagcagaccggg ggagcacgggagaccagctgcctgttggtacacagcccatag

DBGET integrated database retrieval system