Tupaia chinensis (Chinese tree shrew): 102501036 Help Entry 102501036         CDS       T02978                                  Name (RefSeq) cofilin-1   KO K05765   cofilin Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04360   Axon guidance tup04666   Fc gamma R-mediated phagocytosis tup04810   Regulation of actin cytoskeleton tup05133   Pertussis tup05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:tup00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102501036  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     102501036   09158 Development and regeneration    04360 Axon guidance     102501036  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102501036   09171 Infectious disease: bacterial    05133 Pertussis     102501036  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tup04131]     102501036   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tup04812]     102501036    04147 Exosome [BR:tup04147]     102501036 Membrane trafficking [BR:tup04131]  Others   Actin-binding proteins    Others     102501036 Cytoskeleton proteins [BR:tup04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      102501036 Exosome [BR:tup04147]  Exosomal proteins   Proteins found in most exosomes    102501036 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  102501036 NCBI-ProteinID:  XP_006156884 LinkDB All DBs Position Un AA seq 167 aa AA seqDB search MASCVAVSDGIINVFNDVKVRKSSTLEEVRCKKAVLFCLSEDKNIILEERKEILVGNVGQ TVNNPYTTFVKMLPDEDCRYARYNVTYESKESKKEDLVFIFWAPECAPDKSKMIYASSKD AIKKKLMGIKRIKHELQANCYEKFKDHCTLAEKLGGSAFISLEGKPL NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atggcttcttgtgtggctgtctctgacggcatcatcaacgtgttcaatgacgtgaaggtg cgcaagtcatcaacactagaggaggtgaggtgcaagaaggcggtactcttctgcctgagt gaggacaagaacatcatcctggaggagcgcaaggagatcctggtaggtaatgtgggccag actgtcaacaacccctacaccacctttgtcaagatgctgccagatgaagactgccgctat gcccgctataatgtgacctatgagtccaaggagagcaagaaggaagacctggtattcatc ttctgggcccctgaatgtgcacctgataagagcaaaatgatctatgccagctccaaggat gccattaaaaagaaactgatggggattaagcggataaagcatgaattacaagcaaactgc tatgagaagttcaaggatcactgcaccctggcagagaagctgggaggcagtgccttcatc tccctggagggtaaacctttgtga

DBGET integrated database retrieval system