Tupaia chinensis (Chinese tree shrew): 102502051 Help Entry 102502051         CDS       T02978                                  Symbol ARF1 Name (RefSeq) ADP-ribosylation factor 1   KO K07937   ADP-ribosylation factor 1/2 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04072   Phospholipase D signaling pathway tup04144   Endocytosis tup05132   Salmonella infection tup05134   Legionellosis Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     102502051 (ARF1)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102502051 (ARF1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102502051 (ARF1)    05134 Legionellosis     102502051 (ARF1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tup04131]     102502051 (ARF1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tup04147]     102502051 (ARF1)    04031 GTP-binding proteins [BR:tup04031]     102502051 (ARF1) Membrane trafficking [BR:tup04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     102502051 (ARF1)   Arf GTPases and associated proteins    Arf GTPases     102502051 (ARF1)  Endosome - Golgi transport     102502051 (ARF1) Exosome [BR:tup04147]  Exosomal proteins   Proteins found in most exosomes    102502051 (ARF1) GTP-binding proteins [BR:tup04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     102502051 (ARF1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha SRPRB Ras Gtr1_RagA MMR_HSR1 6PF2K FLAD1_M AAA_33 RXYLT1_N Motif Other DBs NCBI-GeneID:  102502051 NCBI-ProteinID:  XP_006147033 LinkDB All DBs Position Un AA seq 135 aa AA seqDB search MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAV LLVFANKQVGIWTNP NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggggaatatctttgcaaacctcttcaagggcctttttggcaaaaaagaaatgcgcatc ctcatggtcggcctggatgctgcagggaagacaacgattctgtacaaactgaagctcggt gaaattgtgactaccattcccaccataggtttcaacgtggagactgtagagtacaaaaac atcagcttcactgtgtgggacgtgggtggccaggacaagatccggcctctgtggcgccac tatttccagaatacacaaggcttgatctttgtggtggacagcaatgacagagagcgtgtg aacgaggcccgcgaggagctcatgaggatgctggctgaagacgagctcagggatgctgtc ctccttgtgtttgccaataagcaagtaggtatctggaccaacccttaa

DBGET integrated database retrieval system