Tupaia chinensis (Chinese tree shrew): 102503239 Help Entry 102503239         CDS       T02978                                  Symbol PFN1, Profilin-1 Name (RefSeq) profilin 1   KO K05759   profilin Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04015   Rap1 signaling pathway tup04810   Regulation of actin cytoskeleton tup05014   Amyotrophic lateral sclerosis tup05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102503239 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102503239 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102503239 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102503239 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tup04131]     102503239 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tup04812]     102503239 (PFN1)    04147 Exosome [BR:tup04147]     102503239 (PFN1) Membrane trafficking [BR:tup04131]  Others   Actin-binding proteins    Others     102503239 (PFN1) Cytoskeleton proteins [BR:tup04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102503239 (PFN1) Exosome [BR:tup04147]  Exosomal proteins   Proteins found in most exosomes    102503239 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102503239 NCBI-ProteinID:  XP_006151927 UniProt:  L9KL20 LinkDB All DBs Position Un AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctacaaggactcgccctccgtctgggccgccgttcccgggaagaccttc gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccggtcgagttttttc gtaaatgggctgacacttggaggccagaaatgttctgtcattcgggactcactgctgcag gatggggagtttaccatggatcttcgtaccaagagcaccggtggagcccccaccttcaac gtcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggcatgatcaacaagaaatgttatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system