Tupaia chinensis (Chinese tree shrew): 106733869 Help Entry 106733869         CDS       T02978                                  Name (RefSeq) tubulin alpha chain   KO K07374   tubulin alpha Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04145   Phagosome tup04210   Apoptosis tup04530   Tight junction tup04540   Gap junction tup04814   Motor proteins tup05010   Alzheimer disease tup05012   Parkinson disease tup05014   Amyotrophic lateral sclerosis tup05016   Huntington disease tup05020   Prion disease tup05022   Pathways of neurodegeneration - multiple diseases tup05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tup00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     106733869   09143 Cell growth and death    04210 Apoptosis     106733869   09144 Cellular community - eukaryotes    04530 Tight junction     106733869    04540 Gap junction     106733869   09142 Cell motility    04814 Motor proteins     106733869  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106733869   09164 Neurodegenerative disease    05010 Alzheimer disease     106733869    05012 Parkinson disease     106733869    05014 Amyotrophic lateral sclerosis     106733869    05016 Huntington disease     106733869    05020 Prion disease     106733869    05022 Pathways of neurodegeneration - multiple diseases     106733869  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tup03019]     106733869    03036 Chromosome and associated proteins [BR:tup03036]     106733869   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tup04812]     106733869    04147 Exosome [BR:tup04147]     106733869 Messenger RNA biogenesis [BR:tup03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      106733869 Chromosome and associated proteins [BR:tup03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Other tubulins      106733869 Cytoskeleton proteins [BR:tup04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulins     106733869 Exosome [BR:tup04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106733869   Exosomal proteins of other body fluids (saliva and urine)    106733869   Exosomal proteins of colorectal cancer cells    106733869 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tubulin_C DUF7281 Motif Other DBs NCBI-GeneID:  106733869 NCBI-ProteinID:  XP_014439565 LinkDB All DBs Position Un AA seq 249 aa AA seqDB search MVDIEAIYDICRRNLDIERPTYTNLNRFIGQIVSSITAYLRFDGALNVYLTEFQTNLVPC PRIHFSLATYAPVISAEKAFHEQLSVTEINKACFEPANQMVKCDPRHGKYMACCLLYRGD VVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTT AIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEG EGEEEGEEY NT seq 750 nt NT seq  +upstreamnt  +downstreamnt atggtagacatcgaggccatctatgacatctgtcgtagaaacctagacattgaacgccca acctacactaacctgaataggtttataggtcaaattgtgtcctccatcactgcttacctt agatttgatggagccttgaatgtctatctgacagaattccagaccaacctggtgccctgt ccccgcatccacttctctctggccacatatgcccctgtcatctctgctgagaaagccttc catgaacagctttctgtaacagagatcaacaaggcttgctttgagcctgccaaccagatg gtgaaatgcgaccctcgccatggtaaatacatggcttgttgcctgttgtaccgtggcgat gtggttcccaaagatgtcaatgctgccattgccaccatcaagaccaagcgcaccatccag tttgtggattggtgccccactggcttcaaggttggcattaactaccagcctcccactgtg gtgcccgggggagacctggccaaggtgcagcgtgctgtgtgcatgctgagcaacaccaca gccattgctgaggcctgggctcgcctggaccacaagtttgacctgatgtatgccaagcgt gccttcgttcactggtacgtaggtgaggggatggaggaaggagagttttctgaggcccga gaggacatggctgcccttgagaaggattatgaggaggttggtgtggattctgttgaagga gagggtgaggaagaaggagaggaatactaa

DBGET integrated database retrieval system