Turicibacter sp. H121: AT726_01005
Help
Entry
AT726_01005 CDS
T04254
Name
(GenBank) phosphopantetheine adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
tur
Turicibacter sp. H121
Pathway
tur00770
Pantothenate and CoA biosynthesis
tur01100
Metabolic pathways
tur01240
Biosynthesis of cofactors
Module
tur_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
tur00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
AT726_01005
Enzymes [BR:
tur01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
AT726_01005
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
Glyco_transf_29
Motif
Other DBs
NCBI-ProteinID:
AMC07709
LinkDB
All DBs
Position
complement(227792..228289)
Genome browser
AA seq
165 aa
AA seq
DB search
MDKVGLYSGTFDPVTNGHLDVIERGYELFDRLYITVAQNINKKTLFTVEERVEMLKCATV
HLPNVEVMVCSDKLVVDFAKEVGAKTILRGLRAVTDFEYEFQIATTNKRLAPEIETVFLM
TKAENMFLSSSTTKEVARFGGDVSSFVPDFVKDALEEKYKILQMK
NT seq
498 nt
NT seq
+upstream
nt +downstream
nt
atggataaagtaggactttactctggaacgtttgatccggtgacgaatggacatttagat
gtcattgagcgcggttatgaactatttgatcgtctttatatcactgtggcgcaaaatatt
aataagaaaacattatttacagttgaagaacgtgtagagatgttaaagtgtgcgacagta
catttacctaatgtagaagtgatggtttgttcagataaattagtcgtagattttgctaaa
gaagtgggagctaaaacgattttacgtggtcttcgtgcggttacagattttgaatacgaa
tttcaaattgcaacgacgaataagcgattagcacctgagattgaaacggtctttttgatg
acaaaagcagaaaatatgtttttatcgtcatcaacgacaaaagaagtcgctcgatttgga
ggcgatgtttcaagttttgtacctgactttgtcaaagacgcgttagaagaaaaatataaa
atattacaaatgaaataa
DBGET
integrated database retrieval system