KEGG   Tetranychus urticae (two-spotted spider mite): 112538460
Entry
112538460         CDS       T04901                                 
Name
(RefSeq) ADP-ribosylation factor-related protein 1-like isoform X1
  KO
K07952  ADP-ribosylation factor related protein 1
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Brite
KEGG Orthology (KO) [BR:tut00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tut04131]
    112538460
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:tut04031]
    112538460
Membrane trafficking [BR:tut04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPases
    112538460
GTP-binding proteins [BR:tut04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arp
    112538460
SSDB
Motif
Pfam: Arf G-alpha Roc Ras SRPRB MMR_HSR1 Gtr1_RagA DO-GTPase2 GTP_EFTU FeoB_N
Other DBs
NCBI-GeneID: 112538460
NCBI-ProteinID: XP_015785340
UniProt: T1KB32
LinkDB
Position
Unknown
AA seq 201 aa
MFSLFYGLWKYIFKRDEFYVLILGLDNAGKTTFLEQTKIKFNRNYKGVNLNKITTTVGLN
IGKIEYKGIVMNFWDLGGQHELQSLWDKYYAESHGIIFIIDSADIERIEESKAAFENMIT
NEHLVGIPLLIVANKQDIPEALSLDRIKSIFKSSASQIGKRDIHSISVSALNSQGITESI
DWMTNCIKRNVPTRPPNNAED
NT seq 606 nt   +upstreamnt  +downstreamnt
atgttttccttgttttatggattatggaaatacatattcaaaagagatgagttttacgtg
ttaattcttggtttagataatgctggtaaaactacttttctggagcagactaaaattaaa
tttaatcgtaattataaaggtgttaatctcaacaagataaccactacagttggattaaat
atcggaaaaattgagtacaaaggtattgtaatgaatttttgggatcttggcggacaacat
gagcttcaatctttatgggataagtattatgcagaatctcatggtataatatttataatt
gattcagctgatattgaaagaattgaggaatcaaaggcagcattcgaaaatatgattaca
aatgaacatcttgttggtattccgctattaattgtagccaataagcaggatattccggaa
gcattgtcacttgatcggattaaatcaattttcaaatcatctgcttctcagattggcaaa
cgagatatacattcaatatctgtctctgcgttaaatagtcaaggcatcactgaaagtatt
gattggatgaccaattgtataaaacgcaatgtcccgactagaccccctaataacgctgag
gactag

DBGET integrated database retrieval system