Thermoproteus uzoniensis: TUZN_0528 Help Entry TUZN_0528         CDS       T01460                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism tuz  Thermoproteus uzoniensis Pathway tuz03010   Ribosome Brite KEGG Orthology (KO) [BR:tuz00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     TUZN_0528   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     TUZN_0528  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tuz03011]     TUZN_0528    04121 Ubiquitin system [BR:tuz04121]     TUZN_0528   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tuz04147]     TUZN_0528 Ribosome [BR:tuz03011]  Ribosomal proteins   Eukaryotes    Small subunit     TUZN_0528   Archaea     TUZN_0528 Ubiquitin system [BR:tuz04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    TUZN_0528 Exosome [BR:tuz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    TUZN_0528   Exosomal proteins of colorectal cancer cells    TUZN_0528 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Cas12f1-like_TNB GFA Zn_ribbon_3 Lar_restr_allev ADK_lid Zn_ribbon_PriA Zn_Ribbon_TF DUF6487 Zn_ribbon_NUD TackOD1 Zn_ribbon_Nudix Zn_ribbon_ISL3 Motif Other DBs NCBI-ProteinID:  AEA12022 UniProt:  F2L3N8 LinkDB All DBs Position complement(460301..460486) Genome browser AA seq 61 aa AA seqDB search MSEAKKLPRSATWYQYDYEKGTIKFLRRLCPRCGSVMAYHKEPVPRWHCGKCGMTIFESK R NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgagcgaggccaagaaattgcccaggtccgctacttggtaccagtacgactacgagaag ggcaccataaagtttctgaggaggctctgtccccgttgtggatccgtcatggcttatcac aaggagcctgtgcccagatggcactgcggcaagtgcgggatgactatattcgagtcgaag cggtag

DBGET integrated database retrieval system