Tachysurus vachellii: 132837754 Help Entry 132837754         CDS       T09596                                  Symbol rab7a Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism tvc  Tachysurus vachellii Pathway tvc04137   Mitophagy - animal tvc04140   Autophagy - animal tvc04144   Endocytosis tvc04145   Phagosome tvc04148   Efferocytosis tvc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tvc00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     132837754 (rab7a)    04145 Phagosome     132837754 (rab7a)    04140 Autophagy - animal     132837754 (rab7a)    04137 Mitophagy - animal     132837754 (rab7a)    04148 Efferocytosis     132837754 (rab7a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     132837754 (rab7a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tvc04131]     132837754 (rab7a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tvc04147]     132837754 (rab7a)    04031 GTP-binding proteins [BR:tvc04031]     132837754 (rab7a) Membrane trafficking [BR:tvc04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     132837754 (rab7a) Exosome [BR:tvc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132837754 (rab7a)   Exosomal proteins of other body fluids (saliva and urine)    132837754 (rab7a)   Exosomal proteins of colorectal cancer cells    132837754 (rab7a)   Exosomal proteins of bladder cancer cells    132837754 (rab7a) GTP-binding proteins [BR:tvc04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     132837754 (rab7a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 NTPase_1 AAA_7 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC ABC_tran SRPRB ATP-synt_ab Motif Other DBs NCBI-GeneID:  132837754 NCBI-ProteinID:  XP_060713563 LinkDB All DBs Position 22:16970451..16980494 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERAKQSPESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctcgaggaagaaagttctgctcaaggtgatcatcctcggagactcgggagtggga aagacctctctgatgaaccagtacgtgaacaagaagtttagcaatcaatacaaagctaca ataggcgccgacttcctgacaaaagaggtgatggtggacgatcggctcgtcacaatgcag atttgggacacagcaggtcaggaacgtttccagtctctgggcgtggcattctaccgcggc gcagactgctgcgtgcttgtcttcgacgtcacggcgccgaacacgttcaagacgctggac agctggagggacgagtttctgatccaggccagccctcgtgaccctgagaacttccccttc gtagtgcttggcaacaaaatcgacctggagaataggcaggtaaccactaagcgagcacaa gcctggtgccagagcaagaataacatcccatactttgagaccagcgcaaaggaggccatc aacgtagaacaagctttccagaccatcgcacgcaacgcactcaaacaggaaaccgaggtg gagttgtacaacgagtttccagagccgatcaagctggacagaaacgagagagccaagcaa tcaccggagagctgcagctgctga

DBGET integrated database retrieval system