Tachysurus vachellii: 132839674 Help Entry 132839674         CDS       T09596                                  Symbol ubl5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism tvc  Tachysurus vachellii Brite KEGG Orthology (KO) [BR:tvc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:tvc03041]     132839674 (ubl5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tvc04052]     132839674 (ubl5) Spliceosome [BR:tvc03041]  Complex B   Other components    Complex B specific factors     132839674 (ubl5) Cytokines and neuropeptides [BR:tvc04052]  Neuropeptides   Unclassified    132839674 (ubl5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  132839674 NCBI-ProteinID:  XP_060716762 LinkDB All DBs Position 24:complement(16788741..16790784) Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNSEDTIGDLKKLIAAQTGTRWDKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggttgtatgtaacgatcgactgggcaaaaaagtccgagtcaaatgcaattct gaagacactatcggggatctgaagaagctaatcgctgctcagacaggaaccaggtgggac aaaatcgtcttgaagaaatggtacactatatttaaggaccacgtgtcgcttggtgactat gagatccatgatgggatgaacctggagctgtattaccagtag

DBGET integrated database retrieval system