Tachysurus vachellii: 132844574 Help Entry 132844574         CDS       T09596                                  Symbol cenps Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism tvc  Tachysurus vachellii Pathway tvc03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:tvc00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     132844574 (cenps)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tvc03036]     132844574 (cenps)    03400 DNA repair and recombination proteins [BR:tvc03400]     132844574 (cenps) Chromosome and associated proteins [BR:tvc03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      132844574 (cenps) DNA repair and recombination proteins [BR:tvc03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      132844574 (cenps) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Histone CBFD_NFYB_HMF TFIID-31kDa TAF Bromo_TP Motif Other DBs NCBI-GeneID:  132844574 NCBI-ProteinID:  XP_060724137 LinkDB All DBs Position 4:complement(18261987..18266648) Genome browser AA seq 131 aa AA seqDB search MSEMDDKDAYTQRLKAAVHYTVGKICQSTATECEKQISKQAVAAIAETTFRQCEIFAKDL EAFARHAKRQTITVDDVKLLARRSTALSSHMQQKIEELAVTNQELKEKRKKNAAKRKSKE MEGNEVEETEN NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atgagtgaaatggacgataaagatgcgtacacacagaggctgaaagcagctgtccactac acggtcgggaaaatttgccagagcacagcaacagagtgcgagaaacagataagcaagcaa gcggtggccgcaattgctgaaactactttcagacagtgtgagatatttgcaaaagatctg gaggcatttgcaagacatgccaaaagacaaacaatcactgtggatgatgtgaaacttcta gcaaggaggagcacagcactatccagccacatgcagcaaaagattgaagaactggcagtg accaaccaggagttgaaggaaaagaggaagaagaatgctgctaagagaaagagtaaagag atggagggaaatgaggtagaggagactgagaactaa

DBGET integrated database retrieval system