Tachysurus vachellii: 132849527 Help Entry 132849527         CDS       T09596                                  Symbol rras2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism tvc  Tachysurus vachellii Pathway tvc04010   MAPK signaling pathway tvc04137   Mitophagy - animal tvc04140   Autophagy - animal tvc04218   Cellular senescence tvc04371   Apelin signaling pathway tvc04625   C-type lectin receptor signaling pathway tvc04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:tvc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     132849527 (rras2)    04371 Apelin signaling pathway     132849527 (rras2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     132849527 (rras2)    04137 Mitophagy - animal     132849527 (rras2)   09143 Cell growth and death    04218 Cellular senescence     132849527 (rras2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     132849527 (rras2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     132849527 (rras2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tvc04147]     132849527 (rras2)    04031 GTP-binding proteins [BR:tvc04031]     132849527 (rras2) Exosome [BR:tvc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    132849527 (rras2)   Exosomal proteins of bladder cancer cells    132849527 (rras2) GTP-binding proteins [BR:tvc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     132849527 (rras2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 SLFN-g3_helicase Motif Other DBs NCBI-GeneID:  132849527 NCBI-ProteinID:  XP_060731547 LinkDB All DBs Position 1:complement(43114473..43148043) Genome browser AA seq 202 aa AA seqDB search MAGWKDGAVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERPA RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM ILVGNKADLELQRQVSPEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE CPPSPEPTRKEKDKSGCHCVIV NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggcgggctggaaggacggcgcggtgcaggagaagtaccgactcgtggtggtgggagga ggcggcgtgggaaaatccgcattaaccatccagttcattcagtcctactttgtcactgat tatgatcccacaatcgaggactcgtacaccaagcagtgtgtgatcgatgagagacctgca cggcttgacatattggacacggcgggacaggaagagttcggggctatgagagaacagtat atgaggacaggagagggattcctgcttgtcttctctgtcactgaccggggcagctttgag gaaatctacaaattccaaagacagattctgagggtgaaggaccgggatgagtttcccatg atccttgtgggcaacaaggccgatctagaactacagagacaggtgagtcctgaggagggg cagcaacttgctcgccagctcaaagtcacctacatggaggcttcagccaaaatccgcatg aatgtagaccaggctttccatgagcttgtccgtgtcatcaggaagttccaggagcaggag tgcccgccctcaccagagccgacacgtaaagagaaggacaagagcggctgccactgtgtg atcgtctga

DBGET integrated database retrieval system