Tachysurus vachellii: 132853276 Help Entry 132853276         CDS       T09596                                  Symbol nras Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism tvc  Tachysurus vachellii Pathway tvc04010   MAPK signaling pathway tvc04012   ErbB signaling pathway tvc04068   FoxO signaling pathway tvc04137   Mitophagy - animal tvc04140   Autophagy - animal tvc04150   mTOR signaling pathway tvc04210   Apoptosis tvc04218   Cellular senescence tvc04370   VEGF signaling pathway tvc04371   Apelin signaling pathway tvc04540   Gap junction tvc04625   C-type lectin receptor signaling pathway tvc04810   Regulation of actin cytoskeleton tvc04910   Insulin signaling pathway tvc04912   GnRH signaling pathway tvc04916   Melanogenesis Brite KEGG Orthology (KO) [BR:tvc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     132853276 (nras)    04012 ErbB signaling pathway     132853276 (nras)    04370 VEGF signaling pathway     132853276 (nras)    04371 Apelin signaling pathway     132853276 (nras)    04068 FoxO signaling pathway     132853276 (nras)    04150 mTOR signaling pathway     132853276 (nras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     132853276 (nras)    04137 Mitophagy - animal     132853276 (nras)   09143 Cell growth and death    04210 Apoptosis     132853276 (nras)    04218 Cellular senescence     132853276 (nras)   09144 Cellular community - eukaryotes    04540 Gap junction     132853276 (nras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     132853276 (nras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     132853276 (nras)   09152 Endocrine system    04910 Insulin signaling pathway     132853276 (nras)    04912 GnRH signaling pathway     132853276 (nras)    04916 Melanogenesis     132853276 (nras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tvc04131]     132853276 (nras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tvc04147]     132853276 (nras)    04031 GTP-binding proteins [BR:tvc04031]     132853276 (nras) Membrane trafficking [BR:tvc04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     132853276 (nras)  Endocytosis   Macropinocytosis    Ras GTPases     132853276 (nras) Exosome [BR:tvc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132853276 (nras)   Exosomal proteins of other body fluids (saliva and urine)    132853276 (nras)   Exosomal proteins of breast cancer cells    132853276 (nras)   Exosomal proteins of colorectal cancer cells    132853276 (nras) GTP-binding proteins [BR:tvc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     132853276 (nras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  132853276 NCBI-ProteinID:  XP_060736850 LinkDB All DBs Position 11:complement(5507804..5512377) Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC LGVSCEVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtataagctggtggtggttggagcaggaggtgtagggaagagcgcgcttacc atccagctcatccagaatcactttgtggacgaatatgaccccaccatagaggactcgtat aggaagcaggtggtgatagacggggagacttgtttgctggacatcctggacaccgcagga caggaggaatatagtgccatgagggaccagtacatgaggactggcgagggcttcctctgt gtgtttgccatcaacaacaccaagtcttttgccgatgtgcatttgtacagggagcagatc aagcgagtaaaggactctgatgatgtgcccatggtcttggttggaaacaaatgtgatttg gccagaaccgtcgacaccaaacaggctcaggaactagccaggagctacggcattgaattt gtagaaacttcagccaagaccagacagggagttgaggatgctttttacaccttggtccgg gagatccgtcattatcgcatgaagaaactcaacagcagggaggacaggaaacagggttgt ctcggagtctcctgcgaagtcatgtga

DBGET integrated database retrieval system