Tachysurus vachellii: 132856833 Help Entry 132856833         CDS       T09596                                  Symbol hrasa Name (RefSeq) HRas proto-oncogene, GTPase a   KO K02833   GTPase HRas Organism tvc  Tachysurus vachellii Pathway tvc04010   MAPK signaling pathway tvc04012   ErbB signaling pathway tvc04068   FoxO signaling pathway tvc04137   Mitophagy - animal tvc04140   Autophagy - animal tvc04144   Endocytosis tvc04150   mTOR signaling pathway tvc04210   Apoptosis tvc04218   Cellular senescence tvc04370   VEGF signaling pathway tvc04371   Apelin signaling pathway tvc04510   Focal adhesion tvc04540   Gap junction tvc04625   C-type lectin receptor signaling pathway tvc04810   Regulation of actin cytoskeleton tvc04910   Insulin signaling pathway tvc04912   GnRH signaling pathway tvc04916   Melanogenesis tvc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tvc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     132856833 (hrasa)    04012 ErbB signaling pathway     132856833 (hrasa)    04370 VEGF signaling pathway     132856833 (hrasa)    04371 Apelin signaling pathway     132856833 (hrasa)    04068 FoxO signaling pathway     132856833 (hrasa)    04150 mTOR signaling pathway     132856833 (hrasa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     132856833 (hrasa)    04140 Autophagy - animal     132856833 (hrasa)    04137 Mitophagy - animal     132856833 (hrasa)   09143 Cell growth and death    04210 Apoptosis     132856833 (hrasa)    04218 Cellular senescence     132856833 (hrasa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     132856833 (hrasa)    04540 Gap junction     132856833 (hrasa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     132856833 (hrasa)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     132856833 (hrasa)   09152 Endocrine system    04910 Insulin signaling pathway     132856833 (hrasa)    04912 GnRH signaling pathway     132856833 (hrasa)    04916 Melanogenesis     132856833 (hrasa)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     132856833 (hrasa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tvc04131]     132856833 (hrasa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tvc04147]     132856833 (hrasa)    04031 GTP-binding proteins [BR:tvc04031]     132856833 (hrasa) Membrane trafficking [BR:tvc04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     132856833 (hrasa)  Endocytosis   Macropinocytosis    Ras GTPases     132856833 (hrasa) Exosome [BR:tvc04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    132856833 (hrasa)   Exosomal proteins of colorectal cancer cells    132856833 (hrasa) GTP-binding proteins [BR:tvc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     132856833 (hrasa) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  132856833 NCBI-ProteinID:  XP_060742634 LinkDB All DBs Position 14:10778432..10794147 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAHELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtataagctggtggtggtgggagctggaggcgtgggcaagagcgctcttacc atccaactcatccagaaccactttgtggacgaatatgaccctaccatagaggactcatac aggaagcaggtggtgattgacggtgagacatgcttgttggacatcctggacacagcaggt caagaggagtacagtgccatgagggaccagtacatgagaacaggagaaggcttcctctgt gtctttgccatcaataacaccaagtcatttgaggacattcatcagtacagggaacaaatc aagcgggtaaaggactctgacgacgtgccaatggtgcttgtgggtaataaatgtgacctt ccagctcgcacagtggacacacggcaagcacacgagcttgcacgcagctacggcatccct tacatcgaaacctcagccaagactagacaaggagtggaggatgcattctacacactagta cgggagatccgacaacacaaactgaggaaactcaatcctccagatgaaagtggacaggac tgcatgagctgtcgctgcgtggtgtcatga

DBGET integrated database retrieval system