Tachysurus vachellii: 132860298 Help Entry 132860298         CDS       T09596                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism tvc  Tachysurus vachellii Pathway tvc04814   Motor proteins tvc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tvc00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     132860298 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     132860298 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:tvc03037]     132860298 (dynll2b)    04812 Cytoskeleton proteins [BR:tvc04812]     132860298 (dynll2b) Cilium and associated proteins [BR:tvc03037]  Motile cilia and associated proteins   Dynein arm    132860298 (dynll2b) Cytoskeleton proteins [BR:tvc04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      132860298 (dynll2b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Nop Ectatomin Motif Other DBs NCBI-GeneID:  132860298 NCBI-ProteinID:  XP_060747442 LinkDB All DBs Position 17:19836683..19841351 Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMTEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacagaaaggccgtgatcaagaatgctgacatgacggaggacatgcagcaggat gctgtggattgtgccacacaggccatggagaagtacaacatcgagaaagacattgctgcc tacatcaagaaggagtttgacaagaagtacaatcccacatggcactgcatcgtgggacgg aacttcggcagctacgtgacgcacgaaacgaaacacttcatctacttctatcttggtcaa gtggcgatcctgctcttcaagtcaggctga

DBGET integrated database retrieval system