Tachysurus vachellii: 132861051 Help Entry 132861051         CDS       T09596                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism tvc  Tachysurus vachellii Pathway tvc04010   MAPK signaling pathway tvc04137   Mitophagy - animal tvc04140   Autophagy - animal tvc04218   Cellular senescence tvc04371   Apelin signaling pathway tvc04625   C-type lectin receptor signaling pathway tvc04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:tvc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     132861051 (rras)    04371 Apelin signaling pathway     132861051 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     132861051 (rras)    04137 Mitophagy - animal     132861051 (rras)   09143 Cell growth and death    04218 Cellular senescence     132861051 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     132861051 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     132861051 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tvc04147]     132861051 (rras)    04031 GTP-binding proteins [BR:tvc04031]     132861051 (rras) Exosome [BR:tvc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    132861051 (rras)   Exosomal proteins of bladder cancer cells    132861051 (rras) GTP-binding proteins [BR:tvc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     132861051 (rras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  132861051 NCBI-ProteinID:  XP_060748376 LinkDB All DBs Position 18:224221..231531 Genome browser AA seq 197 aa AA seqDB search MTSEEERYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDIGSYNEIQKFHTQILRVKDRDDFPMVLVGN KSDLEHQRVVSREEAMSFAKENRIHYMESSAKNRYNVDEAFLEVVRAIRKFQETESPPQL ANHARKQKSGGCPCTIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgacgtcagaagaggagagatacaaactggtggtggtgggaggaggaggtgtgggtaag agtgccctcactatacagtttatacagtcgtacttcgtgtctgactacgacccaaccatc gaggactcgtacaccaaaatctgcaccgtggatgggaaggagacccgactagacattctg gacacagctggtcaggaagagtttggggcgatgcgagagcagtacatgcgatctggagaa ggcttcttactggtgttcgctctgaatgatattggaagctacaatgaaatccagaagttt cacactcagatcctgagggtaaaagatcgagatgatttccccatggtccttgtcggcaac aagtctgatctggagcatcagagagtggtttccagagaagaggccatgtcttttgccaaa gaaaaccggatccactacatggagtcgtcagcgaagaaccgctacaacgtggatgaggct tttctggaggtggtgcgagcaataagaaagtttcaggagacagaaagtcctcctcagctc gcgaatcacgccaggaagcagaagagcggcgggtgtccctgcaccatcctctga

DBGET integrated database retrieval system