Tachysurus vachellii: 132862555 Help Entry 132862555         CDS       T09596                                  Symbol cdc42l2 Name (RefSeq) cell division cycle 42 like 2   KO K04393   cell division control protein 42 Organism tvc  Tachysurus vachellii Pathway tvc04010   MAPK signaling pathway tvc04144   Endocytosis tvc04370   VEGF signaling pathway tvc04510   Focal adhesion tvc04520   Adherens junction tvc04530   Tight junction tvc04810   Regulation of actin cytoskeleton tvc04912   GnRH signaling pathway tvc05100   Bacterial invasion of epithelial cells tvc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tvc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     132862555 (cdc42l2)    04370 VEGF signaling pathway     132862555 (cdc42l2)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     132862555 (cdc42l2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     132862555 (cdc42l2)    04520 Adherens junction     132862555 (cdc42l2)    04530 Tight junction     132862555 (cdc42l2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     132862555 (cdc42l2)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     132862555 (cdc42l2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     132862555 (cdc42l2)    05100 Bacterial invasion of epithelial cells     132862555 (cdc42l2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tvc04131]     132862555 (cdc42l2)    03036 Chromosome and associated proteins [BR:tvc03036]     132862555 (cdc42l2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tvc04147]     132862555 (cdc42l2)    04031 GTP-binding proteins [BR:tvc04031]     132862555 (cdc42l2) Membrane trafficking [BR:tvc04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     132862555 (cdc42l2)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     132862555 (cdc42l2)   Macropinocytosis    Ras GTPases     132862555 (cdc42l2) Chromosome and associated proteins [BR:tvc03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     132862555 (cdc42l2) Exosome [BR:tvc04147]  Exosomal proteins   Exosomal proteins of microglial cells    132862555 (cdc42l2)   Exosomal proteins of breast milk    132862555 (cdc42l2) GTP-binding proteins [BR:tvc04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     132862555 (cdc42l2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  132862555 NCBI-ProteinID:  XP_060750603 LinkDB All DBs Position 19:11402153..11409037 Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP EPKKKPKCLLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagacgattaaatgtgtagtagttggtgatggtgctgtgggtaaaacctgcctcttg atttcatacaccacaaacaagttcccttcggagtacgtacccacagtctttgataactat gctgtaactgtaatgatcggcggtgaaccttacactctcggattatttgacaccgcaggt caggaagattatgatcggttgcgacccctgagctatccccaaactgatgtcttcttagtt tgtttctctgtagtttcaccatcatcctttgaaaatgtcaaggaaaaatgggttcctgag attacccatcactgtccaaagaccccgttcctgctggtcgggactcagattgacttacga gacgatccctcaaccattgagaagcttgccaagaacaagcagaaacctattactccagag acagctgagaaactcgccagggatttaaaagcagtgaaatatgtggaatgttcagcttta acacaaaaagggctaaagaacgtgtttgacgaggccatactcgctgcgctggagccccca gagcccaagaagaagcctaaatgtcttcttttatga

DBGET integrated database retrieval system