Thalassomonas viridans: SG34_002400 Help Entry SG34_002400       CDS       T08831                                  Symbol ccmD Name (GenBank) heme exporter protein CcmD   KO K02196   heme exporter protein D Organism tvd  Thalassomonas viridans Pathway tvd02010   ABC transporters Brite KEGG Orthology (KO) [BR:tvd00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     SG34_002400 (ccmD)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:tvd02000]     SG34_002400 (ccmD) Transporters [BR:tvd02000]  ABC transporters, prokaryotic type   ABC-2 type and other transporters    Heme transporter     SG34_002400 (ccmD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CcmD GLV1-2 PFF1_TM FAM176 OAD_gamma DUF92 DivIC Conotoxin Motif Other DBs NCBI-ProteinID:  WDE05809 UniProt:  A0AAE9Z4B1 LinkDB All DBs Position complement(517865..518110) Genome browser AA seq 81 aa AA seqDB search MQFDSFSDFLHMGGYGFYVWLSYGVGFVLLLLLFLISKAQHNSVKKQIAKRQQRENKLRQ AAEQHKQQARQEHKVSTEVSS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcaatttgacagcttcagtgactttttgcacatggggggttacggcttttatgtctgg ctatcctatggcgtcggctttgtcctgctgttgttgcttttcctgatcagcaaggcacag cataactcggttaaaaagcaaatcgccaaacgccagcagcgcgaaaacaaactgcgccag gcggccgagcagcataagcagcaggcccggcaagaacataaggtttccacagaggtatca tcatga

DBGET integrated database retrieval system