Thalassomonas viridans: SG34_005460
Help
Entry
SG34_005460 CDS
T08831
Symbol
rnc
Name
(GenBank) ribonuclease III
KO
K03685
ribonuclease III [EC:
3.1.26.3
]
Organism
tvd
Thalassomonas viridans
Pathway
tvd03008
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:
tvd00001
]
09120 Genetic Information Processing
09122 Translation
03008 Ribosome biogenesis in eukaryotes
SG34_005460 (rnc)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03019 Messenger RNA biogenesis [BR:
tvd03019
]
SG34_005460 (rnc)
03009 Ribosome biogenesis [BR:
tvd03009
]
SG34_005460 (rnc)
03036 Chromosome and associated proteins [BR:
tvd03036
]
SG34_005460 (rnc)
Enzymes [BR:
tvd01000
]
3. Hydrolases
3.1 Acting on ester bonds
3.1.26 Endoribonucleases producing 5'-phosphomonoesters
3.1.26.3 ribonuclease III
SG34_005460 (rnc)
Messenger RNA biogenesis [BR:
tvd03019
]
Prokaryotic type
Bacterial mRNA degradation factors
RNA degradosome components
Ribonucreases
SG34_005460 (rnc)
Ribosome biogenesis [BR:
tvd03009
]
Eukaryotic type
90S particles
RNase
SG34_005460 (rnc)
Prokaryotic type
rRNA processing factors
SG34_005460 (rnc)
Chromosome and associated proteins [BR:
tvd03036
]
Eukaryotic type
Gene silencing
microRNA pathway
Microprocessor complex
SG34_005460 (rnc)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribonucleas_3_3
Ribonuclease_3
dsrm
RM44_endonuclase
DND1_DSRM
DSRM_2
Motif
Other DBs
NCBI-ProteinID:
WDE08145
UniProt:
A0AAF0CCU1
LinkDB
All DBs
Position
1257928..1258614
Genome browser
AA seq
228 aa
AA seq
DB search
MKNALALNRLMKRISYQFKQPELLTQALTHRSAKGAHNERLEFLGDSILGFVIAEALYEK
FPKNNEGDLTRMRSSLVKGVTLAEIAKDFHLGEHLILGPGELKSGGHRRESILEDAVEAI
IGAVYLDSNIETCRTLVLTWFAKRLAQIKPGHEQKDPKTRLQEFLQGRKIELPLYEVIHT
SGQSHNQEFTVRCTTSVLKNEVITKGTSRRKAEQAAAQQVLELLAHDK
NT seq
687 nt
NT seq
+upstream
nt +downstream
nt
atgaagaatgccctggcccttaaccggctgatgaaaaggatcagttatcaatttaagcaa
cctgagttgttgacccaggcgctgacgcaccgcagcgccaaaggggcccacaacgaacgg
ctggagtttctcggggactccattctcgggtttgtgatagccgaagccttgtatgagaaa
tttccgaaaaataacgaaggtgatctcacccggatgcgttccagcctggtaaagggggtg
acgctggcggaaatcgcaaaagattttcacttgggggaacacctgattttgggaccgggt
gaactgaaaagcggcggccaccgccgggaatccattcttgaagatgcggtggaagccatc
ataggcgctgtctatctggactcgaatatagaaacttgccgtaccctggtcctgacctgg
tttgccaaacgcctggcgcaaatcaaacccggacatgaacagaaagatccgaaaacccgt
ttacaggaatttttacagggacgaaaaattgaattgcctttgtatgaagtgatccatacc
agcggtcagtctcacaaccaggagtttaccgtgcgctgtaccaccagcgtgctgaaaaac
gaagtgataaccaaaggtaccagtcgccgcaaagcagaacaagcggcggcgcagcaagtg
ttggagttgctcgcacatgacaaataa
DBGET
integrated database retrieval system