Thalassomonas viridans: SG34_028150 Help Entry SG34_028150       CDS       T08831                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tvd  Thalassomonas viridans Pathway tvd00998   Biosynthesis of various antibiotics tvd01100   Metabolic pathways tvd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tvd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SG34_028150    00074 Mycolic acid biosynthesis     SG34_028150   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SG34_028150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Motif Other DBs NCBI-ProteinID:  WDE05125 UniProt:  A0AAE9Z1X1 LinkDB All DBs Position complement(6375967..6376227) Genome browser AA seq 86 aa AA seqDB search MRDIKQELETILGEYTSTDLKTLSGDENLADIGIDSLSLVEIIFDIEELFEIKIPHEAEL AQRGFFLDSLADLLHLVTCLYQERQA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcgtgacatcaaacaagagctggaaaccatcttaggcgaatacacaagtacagatctc aagaccctgtccggggatgagaacctggcggacatagggattgattccctgtcactggtg gagattatttttgatatcgaggagctgtttgagatcaagatcccccacgaagccgagctg gcacaacggggatttttcctggattcgctggcggatctgctgcacctggttacttgttta tatcaggagcggcaagcctga

DBGET integrated database retrieval system