Trichophyton verrucosum: TRV_02570 Help Entry TRV_02570         CDS       T01615                                  Name (RefSeq) hypothetical protein   KO K03008   DNA-directed RNA polymerase II subunit RPB11 Organism tve  Trichophyton verrucosum Pathway tve03020   RNA polymerase tve03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tve00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     TRV_02570   09124 Replication and repair    03420 Nucleotide excision repair     TRV_02570  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:tve03021]     TRV_02570    03400 DNA repair and recombination proteins [BR:tve03400]     TRV_02570 Transcription machinery [BR:tve03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Core subunits      TRV_02570 DNA repair and recombination proteins [BR:tve03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       TRV_02570 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_L_2 RNA_pol_L Motif Other DBs NCBI-GeneID:  9583316 NCBI-ProteinID:  XP_003023296 UniProt:  D4D647 LinkDB All DBs AA seq 135 aa AA seqDB search MVDDEHSSPSSWDLVRRRLKSRLILVSDTDSSLVTNSYELPSNKALGVPSTAIFTFNKED HTLGNLIRSRLLQNQHVLFSGYRTDGQITPKEAVLAACHDLVKDLGTFSREFTKEYELRK MVGAGTQQNDAPNGI NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggtcgacgacgagcattcgagtccttcgtcttgggacctggtgagaagaaggttgaag tcgaggttgatactcgtgagtgacactgactcttctctggtgaccaactcctatgaactg ccatctaacaaagctctaggtgtcccttctactgccatctttactttcaacaaggaggac cacaccttgggcaacctgatccgctctcgtctgcttcagaaccagcacgtcctcttctct ggataccgcaccgacggtcagatcacccccaaggaagcagttcttgctgcctgccacgac ctggtcaaggatctcggcaccttcagccgtgagttcaccaaggagtatgagctgcgtaag atggtcggcgccggcacccagcagaacgatgctccaaacggtatctaa

DBGET integrated database retrieval system