Trichophyton verrucosum: TRV_03922 Help Entry TRV_03922         CDS       T01615                                  Name (RefSeq) hypothetical protein   KO K10881   26 proteasome complex subunit DSS1 Organism tve  Trichophyton verrucosum Pathway tve03050   Proteasome tve03440   Homologous recombination Brite KEGG Orthology (KO) [BR:tve00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     TRV_03922   09124 Replication and repair    03440 Homologous recombination     TRV_03922  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tve03019]     TRV_03922    04131 Membrane trafficking [BR:tve04131]     TRV_03922    03051 Proteasome [BR:tve03051]     TRV_03922    03400 DNA repair and recombination proteins [BR:tve03400]     TRV_03922 Messenger RNA biogenesis [BR:tve03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      TRV_03922 Membrane trafficking [BR:tve04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     TRV_03922 Proteasome [BR:tve03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      TRV_03922 DNA repair and recombination proteins [BR:tve03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      TRV_03922 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DSS1_SEM1 Motif Other DBs NCBI-GeneID:  9578847 NCBI-ProteinID:  XP_003021974 UniProt:  D4D9X9 LinkDB All DBs AA seq 119 aa AA seqDB search MSSQPASQGAAKPQSAETAQSEKAQNLSAPLEEDDEFEDFPVEDWPQEEAEAPSGGSGND HLWEESWDDDDASEDFSKQLAWKLPSDDLAVVKEWTLICAATSFLLVSSSASWVFFSGV NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgtcgagtcagcccgcctcacagggcgctgccaaacctcagtcggcggagacagcacag tcagaaaaagcccagaacctttctgcacctctggaagaagatgacgagtttgaagacttc ccggtagaagattggccccaagaagaggcagaagctccgagcggagggtctggcaacgac catctatgggaagaaagctgggatgacgatgatgcgagtgaggacttctctaaacaacta gcgtggaagctgccaagcgatgacttggctgtcgtgaaagaatggactctcatctgtgct gctaccagctttcttcttgtttcctcatcagcctcctgggttttctttagcggagtttag

DBGET integrated database retrieval system