Trichophyton verrucosum: TRV_04927 Help Entry TRV_04927         CDS       T01615                                  Name (RefSeq) hypothetical protein   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism tve  Trichophyton verrucosum Pathway tve03020   RNA polymerase tve03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tve00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     TRV_04927   09124 Replication and repair    03420 Nucleotide excision repair     TRV_04927  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:tve03021]     TRV_04927    03400 DNA repair and recombination proteins [BR:tve03400]     TRV_04927 Transcription machinery [BR:tve03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      TRV_04927   RNA polymerase III system    RNA polymerase III      TRV_04927   RNA polymerase I system    RNA polymerase I      TRV_04927 DNA repair and recombination proteins [BR:tve03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       TRV_04927 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb8 Motif Other DBs NCBI-GeneID:  9577818 NCBI-ProteinID:  XP_003020966 UniProt:  D4DCS2 LinkDB All DBs AA seq 146 aa AA seqDB search MSDPILFEDTFSITSINAQKYDRVSRISCTSTDHLITFTLDVNTEIYPCAPGESLSLALA STLALDGKEEATGERAVWRDVGMGENTLANDYDYVCYGKVYRFEESSTAGNMAVFVSFGG LLLYLDGPYNKLSPLKIDYVYLLMKK NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atgtcggatccgatcctgttcgaagacaccttcagcatcacctcgatcaacgctcagaaa tatgaccgtgtctcgcgcatcagttgtacgtctacagaccatctgatcaccttcaccctc gatgtgaacacggaaatctatccatgcgcccccggagagtcgctgtcgctggctctggcg tcgacattggcgctggatggcaaggaagaagcaaccggtgagagggctgtatggagagac gtaggcatgggggagaacactctggcaaatgactacgactatgtctgctatggaaaggtt tacagatttgaggagagcagcacggcgggcaatatggctgtcttcgtctccttcggcggt cttttgctatatcttgatgggccatacaacaagctcagcccacttaaaattgactacgtc tatcttctcatgaagaagtag

DBGET integrated database retrieval system