Trichophyton verrucosum: TRV_06709 Help Entry TRV_06709         CDS       T01615                                  Name (RefSeq) hypothetical protein   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism tve  Trichophyton verrucosum Pathway tve00480   Glutathione metabolism tve01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:tve00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     TRV_06709  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:tve02000]     TRV_06709 Enzymes [BR:tve01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      TRV_06709 Transporters [BR:tve02000]  Other transporters   Pores ion channels [TC:1]    TRV_06709 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  MAPEG Motif Other DBs NCBI-GeneID:  9577504 NCBI-ProteinID:  XP_003019265 UniProt:  D4DHQ2 LinkDB All DBs AA seq 130 aa AA seqDB search MQGRRESSLNASVHKLYNSIQLLTNWPPPQPKADAFNCAQRAHTNYLENAPQTMLLTLVA GLKYPAATTLIGATWVVMRVLFLYGYVYSGQAAGAGRKYGGGFWFAQMALWGMTVFGVAL PMMQAPASPF NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgcaaggccgacgtgagtcttcccttaatgcgagtgtgcacaaactgtacaactcgatt caactgctaaccaattggcctcccccacagcccaaggccgatgcgttcaactgcgcccag cgagcccacacgaactaccttgagaacgcaccacagacgatgctgctcactctcgttgct ggactcaagtatcctgccgccacgacgttgatcggagctacatgggtggtgatgcgcgtg ctgttcttgtacggatatgtctactccggccaggctgcgggagccggacggaagtacggt ggcggcttctggttcgctcagatggcgctctggggcatgacggtgtttggcgtcgcattg cccatgatgcaagctcctgcttccccgttctag

DBGET integrated database retrieval system