Thiocystis violascens: Thivi_2247 Help Entry Thivi_2247        CDS       T02138                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tvi  Thiocystis violascens Pathway tvi01100   Metabolic pathways tvi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tvi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Thivi_2247    00074 Mycolic acid biosynthesis     Thivi_2247   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Thivi_2247 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ThiG Motif Other DBs NCBI-ProteinID:  AFL74196 UniProt:  I3YB28 LinkDB All DBs Position 2449508..2449795 Genome browser AA seq 95 aa AA seqDB search MEEQAIASQTKPSVDELERLIIQSLRLEETGITAIDPDSALFGDGLGLDSIDALELALVI SKEYGVTISSEQPDIQRIFSSLNHLTAYLQDQRAV NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggaagaacaagcgatagcctcgcagacgaagccttcggtggacgaactggagaggctg atcatccagtcgctgcgactggaagagacgggcattaccgcgatcgatccggacagcgcc ctgttcggcgacggactgggactggattcgatcgacgcgctggaactcgcgctggtcatc agcaaagagtacggggtgaccatcagctccgagcagccggacattcagcggatcttttcc tcgctcaatcatctgacggcctatcttcaggatcagcgagccgtttga

DBGET integrated database retrieval system