Trinickia violacea: FAZ95_00790 Help Entry FAZ95_00790       CDS       T09503                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism tvl  Trinickia violacea Brite KEGG Orthology (KO) [BR:tvl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tvl03036]     FAZ95_00790    03400 DNA repair and recombination proteins [BR:tvl03400]     FAZ95_00790 Chromosome and associated proteins [BR:tvl03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     FAZ95_00790 DNA repair and recombination proteins [BR:tvl03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       FAZ95_00790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N Topoisom_I_N MAGE Motif Other DBs NCBI-ProteinID:  QCP47847 UniProt:  A0A4P8IJL8 LinkDB All DBs Position 1:184382..184681 Genome browser AA seq 99 aa AA seqDB search MSSYKELLAQREKLEKQIEEAKAREYAEVLNEIKQKMADYGITLAELGVSRGKHAKVGRP RAGVAPKYRDPESGSTWSGRGKPPKWIAGQDRDQFLIQK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttacaaggaacttctcgctcaacgagaaaagctggagaagcagatcgaagag gcgaaggcgcgtgaatacgcggaagtgcttaacgagatcaaacaaaaaatggccgactac ggcattacgcttgccgaactcggtgtaagtcgcggtaagcatgcgaaagttggccgtccg cgcgccggcgtcgcgccgaaatatcgcgatcccgaaagcggcagcacctggtcgggccgc ggcaaaccgccgaaatggattgccggccaagatcgcgatcaatttctgattcagaagtaa

DBGET integrated database retrieval system