Trinickia violacea: FAZ95_06685 Help Entry FAZ95_06685       CDS       T09503                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tvl  Trinickia violacea Pathway tvl01100   Metabolic pathways tvl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tvl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FAZ95_06685    00074 Mycolic acid biosynthesis     FAZ95_06685   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FAZ95_06685 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CT398_CC Motif Other DBs NCBI-ProteinID:  QCP51671 UniProt:  A0A4P8ITN4 LinkDB All DBs Position 1:1461004..1461288 Genome browser AA seq 94 aa AA seqDB search MSIPVARMMNELEKELAGLIIRELNLEDIQLEDVSAETPLYGEGFGLDSIDILEIALLIS KKYGFALRSDNPDNAKIFATLGGLAAYVAEHRVR NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgtcaatccccgttgcacgcatgatgaacgaactggaaaaagagctcgctggattgatc atccgcgaactgaaccttgaagacattcagctcgaggacgtgtccgcggagactccgttg tacggcgaaggcttcgggctcgattccatcgacattttggaaatcgcgctcttgatctcc aagaagtacggctttgcgctgcgttcggacaatcccgacaacgccaagattttcgccacg ctgggcggattggccgcctacgtcgcggagcaccgcgtccgctag

DBGET integrated database retrieval system