Trinickia violacea: FAZ95_15720 Help Entry FAZ95_15720       CDS       T09503                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tvl  Trinickia violacea Pathway tvl01100   Metabolic pathways tvl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tvl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FAZ95_15720 (acpP)    00074 Mycolic acid biosynthesis     FAZ95_15720 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FAZ95_15720 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  QCP50473 UniProt:  A0A4P8IT45 LinkDB All DBs Position 1:complement(3440259..3440498) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaatatcgaacagcgcgtcaagaagatcgtcgcagaacaactgggcgttgccgaa gctgagatcaagaacgaagcgtcgttcgtgaacgacctcggcgctgactcgctggatacg gtcgaactcgtgatggcgctggaagacgaattcggcatggaaattccggatgaagaagcc gagaagatcacgaccgtccagcaagcgatcgactacgctcgcgccaacgtcaaggcgtaa

DBGET integrated database retrieval system