Trinickia violacea: FAZ95_24475 Help Entry FAZ95_24475       CDS       T09503                                  Name (GenBank) DNA-binding protein   KO K03746   DNA-binding protein H-NS Organism tvl  Trinickia violacea Brite KEGG Orthology (KO) [BR:tvl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tvl03036]     FAZ95_24475    03400 DNA repair and recombination proteins [BR:tvl03400]     FAZ95_24475 Chromosome and associated proteins [BR:tvl03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     FAZ95_24475 DNA repair and recombination proteins [BR:tvl03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       FAZ95_24475 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS VMAP-M0 Cyclin_N Ivy Spb1_C Motif Other DBs NCBI-ProteinID:  QCP52338 UniProt:  A0A4P8IT20 LinkDB All DBs Position 2:552139..552384 Genome browser AA seq 81 aa AA seqDB search MEQLNGEARDRLIRWLRRRMEEYGITEEALAASVMADRQAEREVLYRDAYGNTWDGHGDL PDWLRRAVAAGQHVEHFRIGG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggaacagctcaatggcgaagctcgcgaccggctcattcgctggctgcggcgccgaatg gaagaatatggcattaccgaagaggcgctcgccgcctccgtgatggcggaccgccaggcg gagcgcgaagtgctataccgggatgcctatggaaatacctgggacggtcacggcgatctg cctgactggctgcgccgcgccgttgcggccgggcagcatgtcgaacattttcgaatcggc ggttaa

DBGET integrated database retrieval system