Trinickia violacea: FAZ95_36050 Help Entry FAZ95_36050       CDS       T09503                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism tvl  Trinickia violacea Brite KEGG Orthology (KO) [BR:tvl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tvl03036]     FAZ95_36050    03400 DNA repair and recombination proteins [BR:tvl03400]     FAZ95_36050 Chromosome and associated proteins [BR:tvl03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     FAZ95_36050 DNA repair and recombination proteins [BR:tvl03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       FAZ95_36050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  QCP54361 UniProt:  A0A4P8J0C6 LinkDB All DBs Position 2:complement(3112795..3113085) Genome browser AA seq 96 aa AA seqDB search MNSYFSLLKQFDQLQREIEIARVREVRRFIDEVFELLNERGVSLDDLVEYRMAVETHQSR GAKVKYRDSATGRTWSGRGREPDWIRGKDRNDFLIE NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaattcctatttttcactactaaagcaattcgaccaactccaacgcgagatcgaaatc gctcgcgtccgtgaggtgcggcgcttcattgacgaggtcttcgaactgctcaacgagcgg ggcgtgagcttggacgatctggtcgaatatcggatggcagtcgagacgcaccagtctcga ggcgcgaaggtgaagtaccgtgactcggcgacaggccgcacgtggagcgggcgaggccgc gaaccagactggattcgtggcaaggatcgaaacgactttctgatcgagtga

DBGET integrated database retrieval system