KEGG   Thermostichus vulcanus: NIES2134_113800
Entry
NIES2134_113800   CDS       T05980                                 
Name
(GenBank) hypothetical protein
  KO
K03722  ATP-dependent DNA helicase DinG [EC:5.6.2.3]
Organism
tvn  Thermostichus vulcanus
Brite
KEGG Orthology (KO) [BR:tvn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tvn03400]
    NIES2134_113800
Enzymes [BR:tvn01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     NIES2134_113800
DNA repair and recombination proteins [BR:tvn03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   DNA helicases
    NIES2134_113800
SSDB
Motif
Pfam: Helicase_C_2
Other DBs
NCBI-ProteinID: BAY51038
LinkDB
Position
1405609..1407081
AA seq 490 aa
MIEAEVHRQLRAFLRSSGDRRWPHHLTLARLVARALRLRRGCLLQVSQRAVLQHRYGLSY
LLPLLLYPEPALLVVPQERLTRLLHQEIPELLSFLAVTKPIQHSHCPQPVFEGVLVMNLE
DWCRQATPYPNVVTIIDGIEALPAIAQQQMTCTITTSDWEHLKLAIPSAIGAIRQVYAQL
VQHLFQRPQNPYGDYLLTPTEQQPLLELLHQWPQSLPPQWSQLRHYLNRDDTVIWGRRHP
TAGYFTLHSHPLNLRPYFQHLWCQAPFVLIGSGPDTDPPLAYVQQELGIPAQTTIKFASD
RHSEAITLAIAEDLPLPNTPEFAPAVLRRLYDLLGTIGHQRAVILVSDVPLREQLATQLA
ALYGSRVQVETTTLETNTILVTGETFWLRHGAQLPCPALLVLTTLPFPSPEKAVVSARIE
WHKRQKQDWFRQYLLPECLTVLDRALAPVRQDDTLVAILDRRLTERSYGREILQSLSPYN
RVRDRAQSPR
NT seq 1473 nt   +upstreamnt  +downstreamnt
gtgattgaggcagaggttcaccgccaattacgggcatttttacgcagcagtggcgatcgc
cggtggcctcaccatctcaccttggcgcggttagtggcccgtgccctgcggctgcggcgg
gggtgtttacttcaggtgagccagcgggcggtgttgcaacatcgctacggcttgagttat
ctgctgccgctgctgttgtatcctgagcctgccctgctagtcgttccccaggagcgactg
acacgactacttcaccaagaaattcctgaactgctcagcttccttgccgtcaccaaacca
attcagcatagccactgcccgcagccagtgtttgagggggtgcttgtgatgaacctcgaa
gactggtgtcgccaagccaccccctaccccaacgtggtcacgatcattgatggcattgaa
gccttgcccgcaattgcccagcagcagatgacctgcacaattaccaccagcgattgggag
cacttgaaattagcaattcccagtgccattggtgccattcgccaagtttatgcccaattg
gtgcaacacctctttcagcggcctcagaatccctatggtgactatctgctcacccccaca
gaacagcaacccctcctggagctgctccatcaatggccgcagtcgctgcctccccaatgg
tcgcaattgcggcactacctcaaccgcgatgacacagtcatctggggacgccgccatccc
acggcaggctactttaccctccatagccaccccctgaatttgcgtccctattttcagcac
ctttggtgccaagccccctttgtcctcattggcagcggacccgatacagacccccctctg
gcctatgtgcagcaggaactagggattccggcccaaacgacgattaaatttgccagcgat
cgccacagtgaagccattacccttgcgatcgccgaagacttacccctaccgaataccccc
gaatttgccccggcggttctgcggcgtctctacgatctccttggcacgattggccatcaa
cgggcggtaatccttgtcagcgatgtgcccctgcgggaacagttggccacccaattggcg
gccctctacggttcacgggtacaggtggagacgacaacccttgagacaaacacgatttta
gtaacgggggaaaccttttggctgcgtcatggggcgcagttaccctgcccggctctattg
gttttgacgacattgcccttcccttccccggaaaaagcagtggtgagtgcccgtattgaa
tggcataagcgacaaaaacaggactggtttcgtcagtatctcttgcccgagtgcttgacg
gtcctggatcgtgcccttgcccctgtgcgtcaggatgataccttggtggccattttggat
cggcggcttacggagcgcagctatggccgcgaaattctccagagtctcagtccctacaac
cgcgttcgggatcgcgcccaatccccgcgttga

DBGET integrated database retrieval system