Thermostichus vulcanus: NIES2134_117970 Help Entry NIES2134_117970   CDS       T05980                                  Symbol acp Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tvn  Thermostichus vulcanus Pathway tvn01100   Metabolic pathways tvn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tvn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NIES2134_117970 (acp)    00074 Mycolic acid biosynthesis     NIES2134_117970 (acp)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NIES2134_117970 (acp) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 ACP_SdgA_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  BAY53120 LinkDB All DBs Position complement(1837270..1837515) Genome browser AA seq 81 aa AA seqDB search MNQSEILEKVKAIVADQLSVDPEKVVPEASFAEDLNADSLDSVELIMALEEEFGVEIPDE EAEKLKTVQDVLDFINNKVAA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaatcaatctgaaattctcgaaaaagtaaaagccattgttgccgatcaactcagtgtt gatccagaaaaagttgtacccgaagccagttttgccgaagacctcaacgctgactccctt gactccgtggagttgatcatggcccttgaggaagagtttggcgtggaaattcccgatgaa gaggcagaaaaactcaaaaccgtccaagatgtccttgactttatcaacaataaggtagct gcatag

DBGET integrated database retrieval system