Thermostichus vulcanus: NIES2134_124360
Help
Entry
NIES2134_124360 CDS
T05980
Symbol
rpl18
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
tvn
Thermostichus vulcanus
Pathway
tvn03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
tvn00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
NIES2134_124360 (rpl18)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
tvn03011
]
NIES2134_124360 (rpl18)
Ribosome [BR:
tvn03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
NIES2134_124360 (rpl18)
Bacteria
NIES2134_124360 (rpl18)
Archaea
NIES2134_124360 (rpl18)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID:
BAY52494
LinkDB
All DBs
Position
complement(2467952..2468314)
Genome browser
AA seq
120 aa
AA seq
DB search
MKQTRTAARQSRHQRIRRKVKGTSDRPRLAVFRSHQHIYAQVIDDTRHHTLVAASSLEPE
LRQKLGKGSTCAASIAVGRLIAERAKAAGIERVVFDRGGNIYHGRVKALADAAREGGLDF
NT seq
363 nt
NT seq
+upstream
nt +downstream
nt
atgaagcaaactcgtactgcggctcgccaaagtcggcaccagcgcattcgccgcaaagtc
aaagggaccagcgatcgcccccgactcgctgtctttcgctcccatcaacacatctatgcc
caagtgattgatgacacccggcatcatactcttgtcgctgcttccagtcttgagccagaa
ctgcggcaaaagctagggaagggcagcacctgtgccgcctccatcgcagtggggcgactg
attgcagagcgggccaaagccgctggcattgagcgtgttgtctttgatcgcggtggcaat
atttaccatgggcgtgtcaaggccttggcggatgccgcccgtgaaggtggattagacttt
tag
DBGET
integrated database retrieval system