Thermoplasma volcanium: TVG1047273 Help Entry TVG1047273        CDS       T00042                                  Symbol TVG1047273 Name (GenBank) ferredoxin Organism tvo  Thermoplasma volcanium Pathway tvo00270   Cysteine and methionine metabolism tvo01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:tvo00001]  09100 Metabolism   09105 Amino acid metabolism    00270 Cysteine and methionine metabolism     TVG1047273 (TVG1047273) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_10 Fer4_6 Fer4_16 Fer4_9 Fer4_21 Fer4_2 Fer4_8 Fer4_4 Fer4_3 Fer4_11 Fer4_17 Fer4_22 Fer4_18 Fer4_15 Fer4_13 Motif Other DBs NCBI-ProteinID:  BAB60166 UniProt:  Q979Y6 LinkDB All DBs Position complement(1047273..1047485) Genome browser AA seq 70 aa AA seqDB search MVELKVKTEMDVDRNLCNYCGACVGMCPTDAIWLDETVIKIHEEKCIECGFCIVGCPTGA INAEWFHGNL NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggtggagctgaaagttaaaacagagatggatgtagatagaaacctctgcaattactgc ggagcctgtgtaggtatgtgtccaaccgatgccatatggctcgatgagacagtaatcaag atccacgaggaaaaatgcatagagtgtggtttttgcatagttggatgcccaactggggca ataaatgcggagtggttccatggaaacttatga

DBGET integrated database retrieval system