KEGG   Trichosurus vulpecula (common brushtail): 118830980
Entry
118830980         CDS       T10126                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tvp  Trichosurus vulpecula (common brushtail)
Pathway
tvp01521  EGFR tyrosine kinase inhibitor resistance
tvp01522  Endocrine resistance
tvp01524  Platinum drug resistance
tvp04010  MAPK signaling pathway
tvp04012  ErbB signaling pathway
tvp04014  Ras signaling pathway
tvp04015  Rap1 signaling pathway
tvp04022  cGMP-PKG signaling pathway
tvp04024  cAMP signaling pathway
tvp04062  Chemokine signaling pathway
tvp04066  HIF-1 signaling pathway
tvp04068  FoxO signaling pathway
tvp04071  Sphingolipid signaling pathway
tvp04072  Phospholipase D signaling pathway
tvp04114  Oocyte meiosis
tvp04140  Autophagy - animal
tvp04148  Efferocytosis
tvp04150  mTOR signaling pathway
tvp04151  PI3K-Akt signaling pathway
tvp04210  Apoptosis
tvp04218  Cellular senescence
tvp04261  Adrenergic signaling in cardiomyocytes
tvp04270  Vascular smooth muscle contraction
tvp04350  TGF-beta signaling pathway
tvp04360  Axon guidance
tvp04370  VEGF signaling pathway
tvp04371  Apelin signaling pathway
tvp04380  Osteoclast differentiation
tvp04510  Focal adhesion
tvp04517  IgSF CAM signaling
tvp04520  Adherens junction
tvp04540  Gap junction
tvp04550  Signaling pathways regulating pluripotency of stem cells
tvp04611  Platelet activation
tvp04613  Neutrophil extracellular trap formation
tvp04620  Toll-like receptor signaling pathway
tvp04621  NOD-like receptor signaling pathway
tvp04625  C-type lectin receptor signaling pathway
tvp04650  Natural killer cell mediated cytotoxicity
tvp04657  IL-17 signaling pathway
tvp04658  Th1 and Th2 cell differentiation
tvp04659  Th17 cell differentiation
tvp04660  T cell receptor signaling pathway
tvp04662  B cell receptor signaling pathway
tvp04664  Fc epsilon RI signaling pathway
tvp04666  Fc gamma R-mediated phagocytosis
tvp04668  TNF signaling pathway
tvp04713  Circadian entrainment
tvp04720  Long-term potentiation
tvp04722  Neurotrophin signaling pathway
tvp04723  Retrograde endocannabinoid signaling
tvp04724  Glutamatergic synapse
tvp04725  Cholinergic synapse
tvp04726  Serotonergic synapse
tvp04730  Long-term depression
tvp04810  Regulation of actin cytoskeleton
tvp04910  Insulin signaling pathway
tvp04912  GnRH signaling pathway
tvp04914  Progesterone-mediated oocyte maturation
tvp04915  Estrogen signaling pathway
tvp04916  Melanogenesis
tvp04917  Prolactin signaling pathway
tvp04919  Thyroid hormone signaling pathway
tvp04921  Oxytocin signaling pathway
tvp04926  Relaxin signaling pathway
tvp04928  Parathyroid hormone synthesis, secretion and action
tvp04929  GnRH secretion
tvp04930  Type II diabetes mellitus
tvp04933  AGE-RAGE signaling pathway in diabetic complications
tvp04934  Cushing syndrome
tvp04935  Growth hormone synthesis, secretion and action
tvp04960  Aldosterone-regulated sodium reabsorption
tvp05010  Alzheimer disease
tvp05020  Prion disease
tvp05022  Pathways of neurodegeneration - multiple diseases
tvp05034  Alcoholism
tvp05132  Salmonella infection
tvp05133  Pertussis
tvp05135  Yersinia infection
tvp05140  Leishmaniasis
tvp05142  Chagas disease
tvp05145  Toxoplasmosis
tvp05152  Tuberculosis
tvp05160  Hepatitis C
tvp05161  Hepatitis B
tvp05163  Human cytomegalovirus infection
tvp05164  Influenza A
tvp05165  Human papillomavirus infection
tvp05166  Human T-cell leukemia virus 1 infection
tvp05167  Kaposi sarcoma-associated herpesvirus infection
tvp05170  Human immunodeficiency virus 1 infection
tvp05171  Coronavirus disease - COVID-19
tvp05200  Pathways in cancer
tvp05203  Viral carcinogenesis
tvp05205  Proteoglycans in cancer
tvp05206  MicroRNAs in cancer
tvp05207  Chemical carcinogenesis - receptor activation
tvp05208  Chemical carcinogenesis - reactive oxygen species
tvp05210  Colorectal cancer
tvp05211  Renal cell carcinoma
tvp05212  Pancreatic cancer
tvp05213  Endometrial cancer
tvp05214  Glioma
tvp05215  Prostate cancer
tvp05216  Thyroid cancer
tvp05218  Melanoma
tvp05219  Bladder cancer
tvp05220  Chronic myeloid leukemia
tvp05221  Acute myeloid leukemia
tvp05223  Non-small cell lung cancer
tvp05224  Breast cancer
tvp05225  Hepatocellular carcinoma
tvp05226  Gastric cancer
tvp05230  Central carbon metabolism in cancer
tvp05231  Choline metabolism in cancer
tvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tvp05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    118830980 (MAPK3)
   04012 ErbB signaling pathway
    118830980 (MAPK3)
   04014 Ras signaling pathway
    118830980 (MAPK3)
   04015 Rap1 signaling pathway
    118830980 (MAPK3)
   04350 TGF-beta signaling pathway
    118830980 (MAPK3)
   04370 VEGF signaling pathway
    118830980 (MAPK3)
   04371 Apelin signaling pathway
    118830980 (MAPK3)
   04668 TNF signaling pathway
    118830980 (MAPK3)
   04066 HIF-1 signaling pathway
    118830980 (MAPK3)
   04068 FoxO signaling pathway
    118830980 (MAPK3)
   04072 Phospholipase D signaling pathway
    118830980 (MAPK3)
   04071 Sphingolipid signaling pathway
    118830980 (MAPK3)
   04024 cAMP signaling pathway
    118830980 (MAPK3)
   04022 cGMP-PKG signaling pathway
    118830980 (MAPK3)
   04151 PI3K-Akt signaling pathway
    118830980 (MAPK3)
   04150 mTOR signaling pathway
    118830980 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    118830980 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    118830980 (MAPK3)
   04148 Efferocytosis
    118830980 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    118830980 (MAPK3)
   04210 Apoptosis
    118830980 (MAPK3)
   04218 Cellular senescence
    118830980 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    118830980 (MAPK3)
   04520 Adherens junction
    118830980 (MAPK3)
   04540 Gap junction
    118830980 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    118830980 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    118830980 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    118830980 (MAPK3)
   04613 Neutrophil extracellular trap formation
    118830980 (MAPK3)
   04620 Toll-like receptor signaling pathway
    118830980 (MAPK3)
   04621 NOD-like receptor signaling pathway
    118830980 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    118830980 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    118830980 (MAPK3)
   04660 T cell receptor signaling pathway
    118830980 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    118830980 (MAPK3)
   04659 Th17 cell differentiation
    118830980 (MAPK3)
   04657 IL-17 signaling pathway
    118830980 (MAPK3)
   04662 B cell receptor signaling pathway
    118830980 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    118830980 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    118830980 (MAPK3)
   04062 Chemokine signaling pathway
    118830980 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    118830980 (MAPK3)
   04929 GnRH secretion
    118830980 (MAPK3)
   04912 GnRH signaling pathway
    118830980 (MAPK3)
   04915 Estrogen signaling pathway
    118830980 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    118830980 (MAPK3)
   04917 Prolactin signaling pathway
    118830980 (MAPK3)
   04921 Oxytocin signaling pathway
    118830980 (MAPK3)
   04926 Relaxin signaling pathway
    118830980 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    118830980 (MAPK3)
   04919 Thyroid hormone signaling pathway
    118830980 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    118830980 (MAPK3)
   04916 Melanogenesis
    118830980 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    118830980 (MAPK3)
   04270 Vascular smooth muscle contraction
    118830980 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    118830980 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    118830980 (MAPK3)
   04725 Cholinergic synapse
    118830980 (MAPK3)
   04726 Serotonergic synapse
    118830980 (MAPK3)
   04720 Long-term potentiation
    118830980 (MAPK3)
   04730 Long-term depression
    118830980 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    118830980 (MAPK3)
   04722 Neurotrophin signaling pathway
    118830980 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    118830980 (MAPK3)
   04380 Osteoclast differentiation
    118830980 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    118830980 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    118830980 (MAPK3)
   05206 MicroRNAs in cancer
    118830980 (MAPK3)
   05205 Proteoglycans in cancer
    118830980 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    118830980 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    118830980 (MAPK3)
   05203 Viral carcinogenesis
    118830980 (MAPK3)
   05230 Central carbon metabolism in cancer
    118830980 (MAPK3)
   05231 Choline metabolism in cancer
    118830980 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    118830980 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    118830980 (MAPK3)
   05212 Pancreatic cancer
    118830980 (MAPK3)
   05225 Hepatocellular carcinoma
    118830980 (MAPK3)
   05226 Gastric cancer
    118830980 (MAPK3)
   05214 Glioma
    118830980 (MAPK3)
   05216 Thyroid cancer
    118830980 (MAPK3)
   05221 Acute myeloid leukemia
    118830980 (MAPK3)
   05220 Chronic myeloid leukemia
    118830980 (MAPK3)
   05218 Melanoma
    118830980 (MAPK3)
   05211 Renal cell carcinoma
    118830980 (MAPK3)
   05219 Bladder cancer
    118830980 (MAPK3)
   05215 Prostate cancer
    118830980 (MAPK3)
   05213 Endometrial cancer
    118830980 (MAPK3)
   05224 Breast cancer
    118830980 (MAPK3)
   05223 Non-small cell lung cancer
    118830980 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    118830980 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    118830980 (MAPK3)
   05161 Hepatitis B
    118830980 (MAPK3)
   05160 Hepatitis C
    118830980 (MAPK3)
   05171 Coronavirus disease - COVID-19
    118830980 (MAPK3)
   05164 Influenza A
    118830980 (MAPK3)
   05163 Human cytomegalovirus infection
    118830980 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    118830980 (MAPK3)
   05165 Human papillomavirus infection
    118830980 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    118830980 (MAPK3)
   05135 Yersinia infection
    118830980 (MAPK3)
   05133 Pertussis
    118830980 (MAPK3)
   05152 Tuberculosis
    118830980 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    118830980 (MAPK3)
   05140 Leishmaniasis
    118830980 (MAPK3)
   05142 Chagas disease
    118830980 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    118830980 (MAPK3)
   05020 Prion disease
    118830980 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    118830980 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    118830980 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    118830980 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    118830980 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    118830980 (MAPK3)
   04934 Cushing syndrome
    118830980 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    118830980 (MAPK3)
   01524 Platinum drug resistance
    118830980 (MAPK3)
   01522 Endocrine resistance
    118830980 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tvp01001]
    118830980 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tvp03036]
    118830980 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tvp04147]
    118830980 (MAPK3)
Enzymes [BR:tvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     118830980 (MAPK3)
Protein kinases [BR:tvp01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   118830980 (MAPK3)
Chromosome and associated proteins [BR:tvp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     118830980 (MAPK3)
Exosome [BR:tvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   118830980 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2
Other DBs
NCBI-GeneID: 118830980
NCBI-ProteinID: XP_036594013
LinkDB
Position
9:complement(78060416..78068102)
AA seq 380 aa
MAAAVAAEGGGGGEPRGVDGSGPGVPGKVEMVKGQPFDVGPRYTELQYIGEGAYGMVSSA
FDHVRKARVAIKKISPFEHQTYCQRTLREIQILLRCHHENVIGIRDILRAPTLEAMRDVY
IVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQDDLNCIINMKARNYLQSLPSKPKVPWVKLFPKA
DPKALDLLDRMLTFNPNKRITVEDALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER
LKELIFQETARFQPGAPGAP
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcggcggcggtggcggctgaggggggagggggcggggagccccggggagttgacggg
tccggcccgggggtcccgggcaaggtggagatggtgaagggccagccgtttgacgtggga
ccgcgctacacagaactgcagtacattggggagggggcgtacggcatggtcagctctgcc
tttgaccacgtgcggaaggcccgggtagccatcaaaaagatcagcccatttgagcaccag
acatattgccagcgcaccctacgggagattcagatcctgcttcgctgccaccacgaaaat
gtcatcggcatccgtgacatccttcgagcacccacactggaggccatgagggatgtctac
attgttcaggacctgatggaaacagacttgtataagctgctcaagagccagcagctgagt
aatgaccatgtctgctacttcctgtaccaaatcctacggggcctcaaatatatccactca
gccaatgtgctccatcgggacctcaaaccctccaacctgctcattaacaccacttgtgac
ctcaagatctgtgactttggcctggcccgaattgcggaccctgagcatgatcacacaggc
tttctgacagagtatgtggctacccgctggtatagagcaccagagatcatgctcaattcc
aagggctatactaaatccatcgatatctggtctgtgggctgtatcctcgcagaaatgctc
tccaatcggcccatcttccctggaaagcactacctggaccagctgaaccacattctaggt
atcctgggttctccatcccaggatgacctgaactgtatcatcaacatgaaggctcggaac
tacctacagtcccttccatccaagcctaaggtgccctgggtcaagctgtttcccaaagca
gaccccaaagccctggacctgctggaccggatgttgacctttaaccccaacaagcgaatc
acagtggaggatgccctggcccatccctacttggagcagtactatgatccaactgatgag
ccagtggcagaagaaccctttacctttgacatggagctggatgacctgccaaaggaacga
ctgaaggagctcatcttccaagagacagcccgattccaacctggagccccaggagccccc
tga

DBGET integrated database retrieval system