KEGG   Trichosurus vulpecula (common brushtail): 118836087
Entry
118836087         CDS       T10126                                 
Name
(RefSeq) B-cell receptor-associated protein 31-like
  KO
K14009  B-cell receptor-associated protein 31
Organism
tvp  Trichosurus vulpecula (common brushtail)
Pathway
tvp04141  Protein processing in endoplasmic reticulum
tvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:tvp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    118836087
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    118836087
SSDB
Motif
Pfam: Bap31 ATG14
Other DBs
NCBI-GeneID: 118836087
NCBI-ProteinID: XP_036599336
LinkDB
Position
2:221836525..221840477
AA seq 229 aa
MSLQWMAVATFFYAEVLAVLLLCSPFISPQKWQKIFSSRLALGLVSHGRPFFGILLLVLV
LLFLDAMWEIRKFDSVEKASLLACPAALEHHQTKLFRAQRNMHVTGFALLLSLLLRRLAT
LQKQQASLQASREAFRRRAQGADQRYLDESERLLQEAEARASQRVAAQVSENQALRKDLR
KLTLELEACRRSLGLAQDEALGLRRRFEKHDRRGEQPEDEAGPEDPRME
NT seq 690 nt   +upstreamnt  +downstreamnt
atgagtctccagtggatggccgtggccaccttcttctacgccgaggtcctggctgtgctg
ctcctctgcagccccttcatctccccgcagaagtggcagaagatcttcagctcccgcctg
gcgctcgggctggtgagccacgggcggcccttcttcgggatcctgctgcttgttctggtg
ctgctcttcctggacgccatgtgggagatcaggaagtttgacagcgtggagaaggcgagc
ctgctggcctgccccgcggccctggagcaccaccagacgaagctcttccgagcgcaacgg
aacatgcacgtcacgggcttcgcgctgctgctgtcgctgctgctgcgccgcctggccacc
ctgcagaagcagcaggcctcgctgcaggcctcccgggaggcctttcggaggcgggcgcaa
ggggccgaccagcgctacctggacgagagcgagcggctgctgcaggaggccgaggcccgg
gcgagccagcgcgtagccgcccaggtgagcgagaaccaggccctgcggaaggacctcagg
aagctgacgctggagctggaggcttgccgcaggagcctggggcttgcccaggacgaggcc
ctgggcctgcgccggcgcttcgagaagcacgaccgccgcggggagcagccggaggacgag
gcgggccctgaagacccgaggatggagtga

DBGET integrated database retrieval system