KEGG   Trichosurus vulpecula (common brushtail): 118844399
Entry
118844399         CDS       T10126                                 
Name
(RefSeq) ATP synthase F(0) complex subunit C2, mitochondrial-like
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
tvp  Trichosurus vulpecula (common brushtail)
Pathway
tvp00190  Oxidative phosphorylation
tvp01100  Metabolic pathways
tvp04714  Thermogenesis
tvp05010  Alzheimer disease
tvp05012  Parkinson disease
tvp05014  Amyotrophic lateral sclerosis
tvp05016  Huntington disease
tvp05020  Prion disease
tvp05022  Pathways of neurodegeneration - multiple diseases
tvp05208  Chemical carcinogenesis - reactive oxygen species
tvp05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tvp00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    118844399
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    118844399
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    118844399
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    118844399
   05012 Parkinson disease
    118844399
   05014 Amyotrophic lateral sclerosis
    118844399
   05016 Huntington disease
    118844399
   05020 Prion disease
    118844399
   05022 Pathways of neurodegeneration - multiple diseases
    118844399
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    118844399
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 118844399
NCBI-ProteinID: XP_036608169
LinkDB
Position
3:complement(233902383..233902823)
AA seq 141 aa
MYACAKFISTPDFVRSSSQPLSRPLTAVVLKRPEVMTDENLSILAASGPLISLVPRCGFQ
TSAISRDIDTAAKFIEAGAATVGVASSGAGIGTVFGSLIISYARKPSLKQQLFSYAILGF
ALSEAMGLFCLMVAFLILFAM
NT seq 426 nt   +upstreamnt  +downstreamnt
atgtatgcctgcgccaagttcatctctacccctgactttgtgaggagcagctctcagccg
ctgagtagaccgttaactgcagtggtactgaaacggccagaggttatgacagatgagaat
ctgagcattttggcagcatcaggtcccttgatctcacttgtccccagatgtgggttccaa
actagtgccatctcaagggacattgacacagcagccaagttcattgaggctggggctgcc
actgtgggggtggccagctctggagctgggattgggactgtgtttggaagtctcatcatc
agttatgccaggaaaccttccctgaagcaacagctcttttcctacgccattctgggcttt
gccctgtctgaggccatggggctcttttgcctgatggtggccttcctcatcctctttgcc
atgtga

DBGET integrated database retrieval system