KEGG   Trichosurus vulpecula (common brushtail): 118847476
Entry
118847476         CDS       T10126                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tvp  Trichosurus vulpecula (common brushtail)
Pathway
tvp01521  EGFR tyrosine kinase inhibitor resistance
tvp01522  Endocrine resistance
tvp01524  Platinum drug resistance
tvp04010  MAPK signaling pathway
tvp04012  ErbB signaling pathway
tvp04014  Ras signaling pathway
tvp04015  Rap1 signaling pathway
tvp04022  cGMP-PKG signaling pathway
tvp04024  cAMP signaling pathway
tvp04062  Chemokine signaling pathway
tvp04066  HIF-1 signaling pathway
tvp04068  FoxO signaling pathway
tvp04071  Sphingolipid signaling pathway
tvp04072  Phospholipase D signaling pathway
tvp04114  Oocyte meiosis
tvp04140  Autophagy - animal
tvp04148  Efferocytosis
tvp04150  mTOR signaling pathway
tvp04151  PI3K-Akt signaling pathway
tvp04210  Apoptosis
tvp04218  Cellular senescence
tvp04261  Adrenergic signaling in cardiomyocytes
tvp04270  Vascular smooth muscle contraction
tvp04350  TGF-beta signaling pathway
tvp04360  Axon guidance
tvp04370  VEGF signaling pathway
tvp04371  Apelin signaling pathway
tvp04380  Osteoclast differentiation
tvp04510  Focal adhesion
tvp04517  IgSF CAM signaling
tvp04520  Adherens junction
tvp04540  Gap junction
tvp04550  Signaling pathways regulating pluripotency of stem cells
tvp04611  Platelet activation
tvp04613  Neutrophil extracellular trap formation
tvp04620  Toll-like receptor signaling pathway
tvp04621  NOD-like receptor signaling pathway
tvp04625  C-type lectin receptor signaling pathway
tvp04650  Natural killer cell mediated cytotoxicity
tvp04657  IL-17 signaling pathway
tvp04658  Th1 and Th2 cell differentiation
tvp04659  Th17 cell differentiation
tvp04660  T cell receptor signaling pathway
tvp04662  B cell receptor signaling pathway
tvp04664  Fc epsilon RI signaling pathway
tvp04666  Fc gamma R-mediated phagocytosis
tvp04668  TNF signaling pathway
tvp04713  Circadian entrainment
tvp04720  Long-term potentiation
tvp04722  Neurotrophin signaling pathway
tvp04723  Retrograde endocannabinoid signaling
tvp04724  Glutamatergic synapse
tvp04725  Cholinergic synapse
tvp04726  Serotonergic synapse
tvp04730  Long-term depression
tvp04810  Regulation of actin cytoskeleton
tvp04910  Insulin signaling pathway
tvp04912  GnRH signaling pathway
tvp04914  Progesterone-mediated oocyte maturation
tvp04915  Estrogen signaling pathway
tvp04916  Melanogenesis
tvp04917  Prolactin signaling pathway
tvp04919  Thyroid hormone signaling pathway
tvp04921  Oxytocin signaling pathway
tvp04926  Relaxin signaling pathway
tvp04928  Parathyroid hormone synthesis, secretion and action
tvp04929  GnRH secretion
tvp04930  Type II diabetes mellitus
tvp04933  AGE-RAGE signaling pathway in diabetic complications
tvp04934  Cushing syndrome
tvp04935  Growth hormone synthesis, secretion and action
tvp04960  Aldosterone-regulated sodium reabsorption
tvp05010  Alzheimer disease
tvp05020  Prion disease
tvp05022  Pathways of neurodegeneration - multiple diseases
tvp05034  Alcoholism
tvp05132  Salmonella infection
tvp05133  Pertussis
tvp05135  Yersinia infection
tvp05140  Leishmaniasis
tvp05142  Chagas disease
tvp05145  Toxoplasmosis
tvp05152  Tuberculosis
tvp05160  Hepatitis C
tvp05161  Hepatitis B
tvp05163  Human cytomegalovirus infection
tvp05164  Influenza A
tvp05165  Human papillomavirus infection
tvp05166  Human T-cell leukemia virus 1 infection
tvp05167  Kaposi sarcoma-associated herpesvirus infection
tvp05170  Human immunodeficiency virus 1 infection
tvp05171  Coronavirus disease - COVID-19
tvp05200  Pathways in cancer
tvp05203  Viral carcinogenesis
tvp05205  Proteoglycans in cancer
tvp05206  MicroRNAs in cancer
tvp05207  Chemical carcinogenesis - receptor activation
tvp05208  Chemical carcinogenesis - reactive oxygen species
tvp05210  Colorectal cancer
tvp05211  Renal cell carcinoma
tvp05212  Pancreatic cancer
tvp05213  Endometrial cancer
tvp05214  Glioma
tvp05215  Prostate cancer
tvp05216  Thyroid cancer
tvp05218  Melanoma
tvp05219  Bladder cancer
tvp05220  Chronic myeloid leukemia
tvp05221  Acute myeloid leukemia
tvp05223  Non-small cell lung cancer
tvp05224  Breast cancer
tvp05225  Hepatocellular carcinoma
tvp05226  Gastric cancer
tvp05230  Central carbon metabolism in cancer
tvp05231  Choline metabolism in cancer
tvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tvp05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    118847476 (MAPK1)
   04012 ErbB signaling pathway
    118847476 (MAPK1)
   04014 Ras signaling pathway
    118847476 (MAPK1)
   04015 Rap1 signaling pathway
    118847476 (MAPK1)
   04350 TGF-beta signaling pathway
    118847476 (MAPK1)
   04370 VEGF signaling pathway
    118847476 (MAPK1)
   04371 Apelin signaling pathway
    118847476 (MAPK1)
   04668 TNF signaling pathway
    118847476 (MAPK1)
   04066 HIF-1 signaling pathway
    118847476 (MAPK1)
   04068 FoxO signaling pathway
    118847476 (MAPK1)
   04072 Phospholipase D signaling pathway
    118847476 (MAPK1)
   04071 Sphingolipid signaling pathway
    118847476 (MAPK1)
   04024 cAMP signaling pathway
    118847476 (MAPK1)
   04022 cGMP-PKG signaling pathway
    118847476 (MAPK1)
   04151 PI3K-Akt signaling pathway
    118847476 (MAPK1)
   04150 mTOR signaling pathway
    118847476 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    118847476 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    118847476 (MAPK1)
   04148 Efferocytosis
    118847476 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    118847476 (MAPK1)
   04210 Apoptosis
    118847476 (MAPK1)
   04218 Cellular senescence
    118847476 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    118847476 (MAPK1)
   04520 Adherens junction
    118847476 (MAPK1)
   04540 Gap junction
    118847476 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    118847476 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    118847476 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    118847476 (MAPK1)
   04613 Neutrophil extracellular trap formation
    118847476 (MAPK1)
   04620 Toll-like receptor signaling pathway
    118847476 (MAPK1)
   04621 NOD-like receptor signaling pathway
    118847476 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    118847476 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    118847476 (MAPK1)
   04660 T cell receptor signaling pathway
    118847476 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    118847476 (MAPK1)
   04659 Th17 cell differentiation
    118847476 (MAPK1)
   04657 IL-17 signaling pathway
    118847476 (MAPK1)
   04662 B cell receptor signaling pathway
    118847476 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    118847476 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    118847476 (MAPK1)
   04062 Chemokine signaling pathway
    118847476 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    118847476 (MAPK1)
   04929 GnRH secretion
    118847476 (MAPK1)
   04912 GnRH signaling pathway
    118847476 (MAPK1)
   04915 Estrogen signaling pathway
    118847476 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    118847476 (MAPK1)
   04917 Prolactin signaling pathway
    118847476 (MAPK1)
   04921 Oxytocin signaling pathway
    118847476 (MAPK1)
   04926 Relaxin signaling pathway
    118847476 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    118847476 (MAPK1)
   04919 Thyroid hormone signaling pathway
    118847476 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    118847476 (MAPK1)
   04916 Melanogenesis
    118847476 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    118847476 (MAPK1)
   04270 Vascular smooth muscle contraction
    118847476 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    118847476 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    118847476 (MAPK1)
   04725 Cholinergic synapse
    118847476 (MAPK1)
   04726 Serotonergic synapse
    118847476 (MAPK1)
   04720 Long-term potentiation
    118847476 (MAPK1)
   04730 Long-term depression
    118847476 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    118847476 (MAPK1)
   04722 Neurotrophin signaling pathway
    118847476 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    118847476 (MAPK1)
   04380 Osteoclast differentiation
    118847476 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    118847476 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    118847476 (MAPK1)
   05206 MicroRNAs in cancer
    118847476 (MAPK1)
   05205 Proteoglycans in cancer
    118847476 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    118847476 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    118847476 (MAPK1)
   05203 Viral carcinogenesis
    118847476 (MAPK1)
   05230 Central carbon metabolism in cancer
    118847476 (MAPK1)
   05231 Choline metabolism in cancer
    118847476 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    118847476 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    118847476 (MAPK1)
   05212 Pancreatic cancer
    118847476 (MAPK1)
   05225 Hepatocellular carcinoma
    118847476 (MAPK1)
   05226 Gastric cancer
    118847476 (MAPK1)
   05214 Glioma
    118847476 (MAPK1)
   05216 Thyroid cancer
    118847476 (MAPK1)
   05221 Acute myeloid leukemia
    118847476 (MAPK1)
   05220 Chronic myeloid leukemia
    118847476 (MAPK1)
   05218 Melanoma
    118847476 (MAPK1)
   05211 Renal cell carcinoma
    118847476 (MAPK1)
   05219 Bladder cancer
    118847476 (MAPK1)
   05215 Prostate cancer
    118847476 (MAPK1)
   05213 Endometrial cancer
    118847476 (MAPK1)
   05224 Breast cancer
    118847476 (MAPK1)
   05223 Non-small cell lung cancer
    118847476 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    118847476 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    118847476 (MAPK1)
   05161 Hepatitis B
    118847476 (MAPK1)
   05160 Hepatitis C
    118847476 (MAPK1)
   05171 Coronavirus disease - COVID-19
    118847476 (MAPK1)
   05164 Influenza A
    118847476 (MAPK1)
   05163 Human cytomegalovirus infection
    118847476 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    118847476 (MAPK1)
   05165 Human papillomavirus infection
    118847476 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    118847476 (MAPK1)
   05135 Yersinia infection
    118847476 (MAPK1)
   05133 Pertussis
    118847476 (MAPK1)
   05152 Tuberculosis
    118847476 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    118847476 (MAPK1)
   05140 Leishmaniasis
    118847476 (MAPK1)
   05142 Chagas disease
    118847476 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    118847476 (MAPK1)
   05020 Prion disease
    118847476 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    118847476 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    118847476 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    118847476 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    118847476 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    118847476 (MAPK1)
   04934 Cushing syndrome
    118847476 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    118847476 (MAPK1)
   01524 Platinum drug resistance
    118847476 (MAPK1)
   01522 Endocrine resistance
    118847476 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tvp01001]
    118847476 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tvp03036]
    118847476 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tvp04147]
    118847476 (MAPK1)
Enzymes [BR:tvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     118847476 (MAPK1)
Protein kinases [BR:tvp01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   118847476 (MAPK1)
Chromosome and associated proteins [BR:tvp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     118847476 (MAPK1)
Exosome [BR:tvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   118847476 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kinase-like Kdo
Other DBs
NCBI-GeneID: 118847476
NCBI-ProteinID: XP_036611859
LinkDB
Position
1:complement(7610693..7690490)
AA seq 362 aa
MAAAAGGGGGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISP
FEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPAIEQMKDVYIVQDLMETDLYKLLKT
QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDH
DHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLN
HILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADPKALDLLDKMLTFNP
HKRIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
RS
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggcggcggcggcgggaggcggcggcggcgcggggcccgagatggtccgcgggcaggtg
ttcgacgtgggcccgcgctacaccaacctctcctacatcggcgagggcgcctacggcatg
gtgtgttccgcatatgacaatgtcaacaaggtccgagtggccatcaagaaaatcagcccc
tttgagcaccagacctactgccagcggacgctgcgtgagatcaagatcttgctgcgcttc
cgccatgagaacatcatcggcatcaatgacatcatccgggccccggccatcgagcagatg
aaagatgtatacatagtccaggacctcatggaaacagacctttacaagctcctaaagacg
cagcatctcagcaatgaccacatctgttatttcctttatcagatcctacgaggtttaaag
tacatccactcagccaacgttctgcaccgtgacctcaagccttccaacctgctgctcaac
accacctgcgatctcaagatctgtgactttggcctggctcgtgtggcagatccagaccac
gaccacacaggcttcctgacggaatatgtggccacgcgctggtaccgagcccctgaaatc
atgctgaactccaagggttacaccaagtccattgacatctggtctgtgggctgtatcctg
gcggagatgctctccaacagacccattttccctgggaaacattaccttgatcagctgaac
cacattcttggcattcttggatccccatcacaagaagacttgaattgcataataaactta
aaagccaggaactacttgctctctcttcctcacaaaaacaaggtgccatggaatcgactc
ttccccaacgctgaccccaaagctctggatttgttggataagatgttgacatttaaccct
cacaagaggatcgaggtggagcaggccctggcccatccctacctggagcagtattatgac
ccaagtgatgagcctgtagccgaagccccattcaagtttgacatggaactggatgacctc
cctaaggagaagctgaaagaactgatttttgaagagactgcgagattccaacccggatac
cgatcttaa

DBGET integrated database retrieval system