KEGG   Trichosurus vulpecula (common brushtail): 118850478
Entry
118850478         CDS       T10126                                 
Name
(RefSeq) calmodulin-A-like
  KO
K02183  calmodulin
Organism
tvp  Trichosurus vulpecula (common brushtail)
Pathway
tvp04014  Ras signaling pathway
tvp04015  Rap1 signaling pathway
tvp04020  Calcium signaling pathway
tvp04022  cGMP-PKG signaling pathway
tvp04024  cAMP signaling pathway
tvp04070  Phosphatidylinositol signaling system
tvp04114  Oocyte meiosis
tvp04218  Cellular senescence
tvp04261  Adrenergic signaling in cardiomyocytes
tvp04270  Vascular smooth muscle contraction
tvp04371  Apelin signaling pathway
tvp04625  C-type lectin receptor signaling pathway
tvp04713  Circadian entrainment
tvp04720  Long-term potentiation
tvp04722  Neurotrophin signaling pathway
tvp04728  Dopaminergic synapse
tvp04740  Olfactory transduction
tvp04744  Phototransduction
tvp04750  Inflammatory mediator regulation of TRP channels
tvp04910  Insulin signaling pathway
tvp04912  GnRH signaling pathway
tvp04915  Estrogen signaling pathway
tvp04916  Melanogenesis
tvp04921  Oxytocin signaling pathway
tvp04922  Glucagon signaling pathway
tvp04924  Renin secretion
tvp04925  Aldosterone synthesis and secretion
tvp04970  Salivary secretion
tvp04971  Gastric acid secretion
tvp05010  Alzheimer disease
tvp05012  Parkinson disease
tvp05022  Pathways of neurodegeneration - multiple diseases
tvp05031  Amphetamine addiction
tvp05034  Alcoholism
tvp05133  Pertussis
tvp05152  Tuberculosis
tvp05163  Human cytomegalovirus infection
tvp05167  Kaposi sarcoma-associated herpesvirus infection
tvp05170  Human immunodeficiency virus 1 infection
tvp05200  Pathways in cancer
tvp05214  Glioma
tvp05417  Lipid and atherosclerosis
tvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    118850478
   04015 Rap1 signaling pathway
    118850478
   04371 Apelin signaling pathway
    118850478
   04020 Calcium signaling pathway
    118850478
   04070 Phosphatidylinositol signaling system
    118850478
   04024 cAMP signaling pathway
    118850478
   04022 cGMP-PKG signaling pathway
    118850478
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    118850478
   04218 Cellular senescence
    118850478
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    118850478
  09152 Endocrine system
   04910 Insulin signaling pathway
    118850478
   04922 Glucagon signaling pathway
    118850478
   04912 GnRH signaling pathway
    118850478
   04915 Estrogen signaling pathway
    118850478
   04921 Oxytocin signaling pathway
    118850478
   04916 Melanogenesis
    118850478
   04924 Renin secretion
    118850478
   04925 Aldosterone synthesis and secretion
    118850478
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    118850478
   04270 Vascular smooth muscle contraction
    118850478
  09154 Digestive system
   04970 Salivary secretion
    118850478
   04971 Gastric acid secretion
    118850478
  09156 Nervous system
   04728 Dopaminergic synapse
    118850478
   04720 Long-term potentiation
    118850478
   04722 Neurotrophin signaling pathway
    118850478
  09157 Sensory system
   04744 Phototransduction
    118850478
   04740 Olfactory transduction
    118850478
   04750 Inflammatory mediator regulation of TRP channels
    118850478
  09159 Environmental adaptation
   04713 Circadian entrainment
    118850478
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    118850478
  09162 Cancer: specific types
   05214 Glioma
    118850478
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    118850478
   05163 Human cytomegalovirus infection
    118850478
   05167 Kaposi sarcoma-associated herpesvirus infection
    118850478
  09171 Infectious disease: bacterial
   05133 Pertussis
    118850478
   05152 Tuberculosis
    118850478
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    118850478
   05012 Parkinson disease
    118850478
   05022 Pathways of neurodegeneration - multiple diseases
    118850478
  09165 Substance dependence
   05031 Amphetamine addiction
    118850478
   05034 Alcoholism
    118850478
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    118850478
   05418 Fluid shear stress and atherosclerosis
    118850478
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tvp01009]
    118850478
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tvp04131]
    118850478
   03036 Chromosome and associated proteins [BR:tvp03036]
    118850478
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tvp04147]
    118850478
Protein phosphatases and associated proteins [BR:tvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     118850478
Membrane trafficking [BR:tvp04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    118850478
Chromosome and associated proteins [BR:tvp03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     118850478
Exosome [BR:tvp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   118850478
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EF-hand_9 CFAP251_C EF-hand_FSTL1 Allatotropin-like_C EH SPARC_Ca_bdg EF-hand_11 EF_EFCAB10_C UPF0154 EFhand_Ca_insen SAPC2_N DUF5580_M Dockerin_1 RNA_pol_Rpb4 EF-hand_EFHB_C DUF1103 Caleosin BamM_C EF-hand_STIM1 SurA_N_3 FCaBP_EF-hand Fe_hyd_lg_C
Other DBs
NCBI-GeneID: 118850478
NCBI-ProteinID: XP_036615805
LinkDB
Position
5:208152987..208153661
AA seq 149 aa
MADQFSEEQIAEFKEAFSLFDKDSDGCITTKELGTVMRSLGQNPTEAELKNMIGEIDTDG
NGTIDFPEFLSMMARKMKDTDSEEEIREAFRVFDKDGNGFVSAAELRHVMTKLGEKLTDD
EVDEMIREADVDGDGQVNYEEFVRMLISK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggccgaccagttttcagaggagcagattgctgaattcaaagaggctttcagccttttt
gacaaggattctgatggctgcatcaccactaaggaactgggcactgtgatgaggtcacta
ggccagaaccccacggaggccgagctgaagaacatgattggagagattgatactgatggt
aatggtaccattgatttccctgagttcttgagcatgatggcaaggaagatgaaggacacg
gacagtgaggaggagatccgggaggctttccgggtgtttgacaaggatggcaatggcttt
gtcagtgcagcagagctaaggcatgtgatgaccaagctcggggaaaagctgacagacgat
gaagtcgatgagatgatccgggaagctgatgttgatggtgatggccaggtgaactatgag
gaatttgtccgcatgcttatctctaagtag

DBGET integrated database retrieval system