KEGG   Trichosurus vulpecula (common brushtail): 118851647
Entry
118851647         CDS       T10126                                 
Name
(RefSeq) GTPase HRas-like
  KO
K02833  GTPase HRas
Organism
tvp  Trichosurus vulpecula (common brushtail)
Pathway
tvp01521  EGFR tyrosine kinase inhibitor resistance
tvp01522  Endocrine resistance
tvp04010  MAPK signaling pathway
tvp04012  ErbB signaling pathway
tvp04014  Ras signaling pathway
tvp04015  Rap1 signaling pathway
tvp04062  Chemokine signaling pathway
tvp04068  FoxO signaling pathway
tvp04071  Sphingolipid signaling pathway
tvp04072  Phospholipase D signaling pathway
tvp04137  Mitophagy - animal
tvp04140  Autophagy - animal
tvp04144  Endocytosis
tvp04150  mTOR signaling pathway
tvp04151  PI3K-Akt signaling pathway
tvp04210  Apoptosis
tvp04211  Longevity regulating pathway
tvp04213  Longevity regulating pathway - multiple species
tvp04218  Cellular senescence
tvp04360  Axon guidance
tvp04370  VEGF signaling pathway
tvp04371  Apelin signaling pathway
tvp04510  Focal adhesion
tvp04540  Gap junction
tvp04550  Signaling pathways regulating pluripotency of stem cells
tvp04625  C-type lectin receptor signaling pathway
tvp04630  JAK-STAT signaling pathway
tvp04650  Natural killer cell mediated cytotoxicity
tvp04660  T cell receptor signaling pathway
tvp04662  B cell receptor signaling pathway
tvp04664  Fc epsilon RI signaling pathway
tvp04714  Thermogenesis
tvp04720  Long-term potentiation
tvp04722  Neurotrophin signaling pathway
tvp04725  Cholinergic synapse
tvp04726  Serotonergic synapse
tvp04730  Long-term depression
tvp04810  Regulation of actin cytoskeleton
tvp04910  Insulin signaling pathway
tvp04912  GnRH signaling pathway
tvp04915  Estrogen signaling pathway
tvp04916  Melanogenesis
tvp04917  Prolactin signaling pathway
tvp04919  Thyroid hormone signaling pathway
tvp04921  Oxytocin signaling pathway
tvp04926  Relaxin signaling pathway
tvp04929  GnRH secretion
tvp04933  AGE-RAGE signaling pathway in diabetic complications
tvp04935  Growth hormone synthesis, secretion and action
tvp05010  Alzheimer disease
tvp05022  Pathways of neurodegeneration - multiple diseases
tvp05034  Alcoholism
tvp05132  Salmonella infection
tvp05160  Hepatitis C
tvp05161  Hepatitis B
tvp05163  Human cytomegalovirus infection
tvp05165  Human papillomavirus infection
tvp05166  Human T-cell leukemia virus 1 infection
tvp05167  Kaposi sarcoma-associated herpesvirus infection
tvp05170  Human immunodeficiency virus 1 infection
tvp05200  Pathways in cancer
tvp05203  Viral carcinogenesis
tvp05205  Proteoglycans in cancer
tvp05206  MicroRNAs in cancer
tvp05207  Chemical carcinogenesis - receptor activation
tvp05208  Chemical carcinogenesis - reactive oxygen species
tvp05210  Colorectal cancer
tvp05211  Renal cell carcinoma
tvp05213  Endometrial cancer
tvp05214  Glioma
tvp05215  Prostate cancer
tvp05216  Thyroid cancer
tvp05218  Melanoma
tvp05219  Bladder cancer
tvp05220  Chronic myeloid leukemia
tvp05221  Acute myeloid leukemia
tvp05223  Non-small cell lung cancer
tvp05224  Breast cancer
tvp05225  Hepatocellular carcinoma
tvp05226  Gastric cancer
tvp05230  Central carbon metabolism in cancer
tvp05231  Choline metabolism in cancer
tvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tvp05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    118851647
   04012 ErbB signaling pathway
    118851647
   04014 Ras signaling pathway
    118851647
   04015 Rap1 signaling pathway
    118851647
   04370 VEGF signaling pathway
    118851647
   04371 Apelin signaling pathway
    118851647
   04630 JAK-STAT signaling pathway
    118851647
   04068 FoxO signaling pathway
    118851647
   04072 Phospholipase D signaling pathway
    118851647
   04071 Sphingolipid signaling pathway
    118851647
   04151 PI3K-Akt signaling pathway
    118851647
   04150 mTOR signaling pathway
    118851647
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    118851647
   04140 Autophagy - animal
    118851647
   04137 Mitophagy - animal
    118851647
  09143 Cell growth and death
   04210 Apoptosis
    118851647
   04218 Cellular senescence
    118851647
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    118851647
   04540 Gap junction
    118851647
   04550 Signaling pathways regulating pluripotency of stem cells
    118851647
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    118851647
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    118851647
   04650 Natural killer cell mediated cytotoxicity
    118851647
   04660 T cell receptor signaling pathway
    118851647
   04662 B cell receptor signaling pathway
    118851647
   04664 Fc epsilon RI signaling pathway
    118851647
   04062 Chemokine signaling pathway
    118851647
  09152 Endocrine system
   04910 Insulin signaling pathway
    118851647
   04929 GnRH secretion
    118851647
   04912 GnRH signaling pathway
    118851647
   04915 Estrogen signaling pathway
    118851647
   04917 Prolactin signaling pathway
    118851647
   04921 Oxytocin signaling pathway
    118851647
   04926 Relaxin signaling pathway
    118851647
   04935 Growth hormone synthesis, secretion and action
    118851647
   04919 Thyroid hormone signaling pathway
    118851647
   04916 Melanogenesis
    118851647
  09156 Nervous system
   04725 Cholinergic synapse
    118851647
   04726 Serotonergic synapse
    118851647
   04720 Long-term potentiation
    118851647
   04730 Long-term depression
    118851647
   04722 Neurotrophin signaling pathway
    118851647
  09158 Development and regeneration
   04360 Axon guidance
    118851647
  09149 Aging
   04211 Longevity regulating pathway
    118851647
   04213 Longevity regulating pathway - multiple species
    118851647
  09159 Environmental adaptation
   04714 Thermogenesis
    118851647
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    118851647
   05206 MicroRNAs in cancer
    118851647
   05205 Proteoglycans in cancer
    118851647
   05207 Chemical carcinogenesis - receptor activation
    118851647
   05208 Chemical carcinogenesis - reactive oxygen species
    118851647
   05203 Viral carcinogenesis
    118851647
   05230 Central carbon metabolism in cancer
    118851647
   05231 Choline metabolism in cancer
    118851647
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    118851647
  09162 Cancer: specific types
   05210 Colorectal cancer
    118851647
   05225 Hepatocellular carcinoma
    118851647
   05226 Gastric cancer
    118851647
   05214 Glioma
    118851647
   05216 Thyroid cancer
    118851647
   05221 Acute myeloid leukemia
    118851647
   05220 Chronic myeloid leukemia
    118851647
   05218 Melanoma
    118851647
   05211 Renal cell carcinoma
    118851647
   05219 Bladder cancer
    118851647
   05215 Prostate cancer
    118851647
   05213 Endometrial cancer
    118851647
   05224 Breast cancer
    118851647
   05223 Non-small cell lung cancer
    118851647
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    118851647
   05170 Human immunodeficiency virus 1 infection
    118851647
   05161 Hepatitis B
    118851647
   05160 Hepatitis C
    118851647
   05163 Human cytomegalovirus infection
    118851647
   05167 Kaposi sarcoma-associated herpesvirus infection
    118851647
   05165 Human papillomavirus infection
    118851647
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    118851647
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    118851647
   05022 Pathways of neurodegeneration - multiple diseases
    118851647
  09165 Substance dependence
   05034 Alcoholism
    118851647
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    118851647
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    118851647
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    118851647
   01522 Endocrine resistance
    118851647
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tvp04131]
    118851647
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tvp04147]
    118851647
   04031 GTP-binding proteins [BR:tvp04031]
    118851647
Membrane trafficking [BR:tvp04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    118851647
 Endocytosis
  Macropinocytosis
   Ras GTPases
    118851647
Exosome [BR:tvp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   118851647
  Exosomal proteins of colorectal cancer cells
   118851647
GTP-binding proteins [BR:tvp04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    118851647
SSDB
Motif
Pfam: Ras Roc GTP_EFTU RsgA_GTPase Arf CdhD FeoB_N
Other DBs
NCBI-GeneID: 118851647
NCBI-ProteinID: XP_036617054
LinkDB
Position
5:262611733..262620204
AA seq 164 aa
SYFGDKEDPVISDSHRKQVVIDGETCLLDILDTASQEEYSATRDQYMRTGEGFLCVFAIN
NTKSSEDIHQYREQIKRVKDSDDVPVVLVGNKCDLPARTVETRQAQELARSYGIPYIETS
AKTSQGVEDAFYTLVREIRQRKLRKVNPPDESGPGCLNCKCVIS
NT seq 495 nt   +upstreamnt  +downstreamnt
tcttactttggtgacaaagaagatccagtgatctcggactcacacaggaagcaggtggtc
attgatggggagacctgtctgcttgacatcttggacactgcaagccaggaggaatacagt
gccacgagagatcagtacatgcgcactggggagggtttcctctgtgtgtttgccattaac
aacacgaagtcctccgaggacattcaccagtacagggagcagattaagcgagtaaaggac
tcagatgatgtgcccgtggtgttggtggggaacaaatgtgacctaccagcccggacagtg
gagacgcgccaggcgcaggagctggcccgaagctatgggatcccctacattgagacgtct
gccaaaactagccaaggggtggaggatgctttctacactctggtgcgggaaatccggcag
cgcaaactgcggaaggtgaatccccctgacgagagcggcccggggtgtctgaactgcaag
tgtgtgatctcctga

DBGET integrated database retrieval system