KEGG   Trichosurus vulpecula (common brushtail): 118856865
Entry
118856865         CDS       T10126                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
tvp  Trichosurus vulpecula (common brushtail)
Pathway
tvp01521  EGFR tyrosine kinase inhibitor resistance
tvp01522  Endocrine resistance
tvp04010  MAPK signaling pathway
tvp04012  ErbB signaling pathway
tvp04014  Ras signaling pathway
tvp04015  Rap1 signaling pathway
tvp04062  Chemokine signaling pathway
tvp04068  FoxO signaling pathway
tvp04071  Sphingolipid signaling pathway
tvp04072  Phospholipase D signaling pathway
tvp04137  Mitophagy - animal
tvp04140  Autophagy - animal
tvp04150  mTOR signaling pathway
tvp04151  PI3K-Akt signaling pathway
tvp04210  Apoptosis
tvp04211  Longevity regulating pathway
tvp04213  Longevity regulating pathway - multiple species
tvp04218  Cellular senescence
tvp04360  Axon guidance
tvp04370  VEGF signaling pathway
tvp04371  Apelin signaling pathway
tvp04540  Gap junction
tvp04550  Signaling pathways regulating pluripotency of stem cells
tvp04625  C-type lectin receptor signaling pathway
tvp04650  Natural killer cell mediated cytotoxicity
tvp04660  T cell receptor signaling pathway
tvp04662  B cell receptor signaling pathway
tvp04664  Fc epsilon RI signaling pathway
tvp04714  Thermogenesis
tvp04720  Long-term potentiation
tvp04722  Neurotrophin signaling pathway
tvp04725  Cholinergic synapse
tvp04726  Serotonergic synapse
tvp04730  Long-term depression
tvp04810  Regulation of actin cytoskeleton
tvp04910  Insulin signaling pathway
tvp04912  GnRH signaling pathway
tvp04915  Estrogen signaling pathway
tvp04916  Melanogenesis
tvp04917  Prolactin signaling pathway
tvp04919  Thyroid hormone signaling pathway
tvp04921  Oxytocin signaling pathway
tvp04926  Relaxin signaling pathway
tvp04929  GnRH secretion
tvp04933  AGE-RAGE signaling pathway in diabetic complications
tvp04935  Growth hormone synthesis, secretion and action
tvp05010  Alzheimer disease
tvp05022  Pathways of neurodegeneration - multiple diseases
tvp05034  Alcoholism
tvp05160  Hepatitis C
tvp05161  Hepatitis B
tvp05163  Human cytomegalovirus infection
tvp05165  Human papillomavirus infection
tvp05166  Human T-cell leukemia virus 1 infection
tvp05167  Kaposi sarcoma-associated herpesvirus infection
tvp05170  Human immunodeficiency virus 1 infection
tvp05200  Pathways in cancer
tvp05203  Viral carcinogenesis
tvp05205  Proteoglycans in cancer
tvp05206  MicroRNAs in cancer
tvp05207  Chemical carcinogenesis - receptor activation
tvp05208  Chemical carcinogenesis - reactive oxygen species
tvp05210  Colorectal cancer
tvp05211  Renal cell carcinoma
tvp05213  Endometrial cancer
tvp05214  Glioma
tvp05215  Prostate cancer
tvp05216  Thyroid cancer
tvp05218  Melanoma
tvp05219  Bladder cancer
tvp05220  Chronic myeloid leukemia
tvp05221  Acute myeloid leukemia
tvp05223  Non-small cell lung cancer
tvp05224  Breast cancer
tvp05225  Hepatocellular carcinoma
tvp05226  Gastric cancer
tvp05230  Central carbon metabolism in cancer
tvp05231  Choline metabolism in cancer
tvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tvp05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    118856865 (NRAS)
   04012 ErbB signaling pathway
    118856865 (NRAS)
   04014 Ras signaling pathway
    118856865 (NRAS)
   04015 Rap1 signaling pathway
    118856865 (NRAS)
   04370 VEGF signaling pathway
    118856865 (NRAS)
   04371 Apelin signaling pathway
    118856865 (NRAS)
   04068 FoxO signaling pathway
    118856865 (NRAS)
   04072 Phospholipase D signaling pathway
    118856865 (NRAS)
   04071 Sphingolipid signaling pathway
    118856865 (NRAS)
   04151 PI3K-Akt signaling pathway
    118856865 (NRAS)
   04150 mTOR signaling pathway
    118856865 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    118856865 (NRAS)
   04137 Mitophagy - animal
    118856865 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    118856865 (NRAS)
   04218 Cellular senescence
    118856865 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    118856865 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    118856865 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    118856865 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    118856865 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    118856865 (NRAS)
   04660 T cell receptor signaling pathway
    118856865 (NRAS)
   04662 B cell receptor signaling pathway
    118856865 (NRAS)
   04664 Fc epsilon RI signaling pathway
    118856865 (NRAS)
   04062 Chemokine signaling pathway
    118856865 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    118856865 (NRAS)
   04929 GnRH secretion
    118856865 (NRAS)
   04912 GnRH signaling pathway
    118856865 (NRAS)
   04915 Estrogen signaling pathway
    118856865 (NRAS)
   04917 Prolactin signaling pathway
    118856865 (NRAS)
   04921 Oxytocin signaling pathway
    118856865 (NRAS)
   04926 Relaxin signaling pathway
    118856865 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    118856865 (NRAS)
   04919 Thyroid hormone signaling pathway
    118856865 (NRAS)
   04916 Melanogenesis
    118856865 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    118856865 (NRAS)
   04726 Serotonergic synapse
    118856865 (NRAS)
   04720 Long-term potentiation
    118856865 (NRAS)
   04730 Long-term depression
    118856865 (NRAS)
   04722 Neurotrophin signaling pathway
    118856865 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    118856865 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    118856865 (NRAS)
   04213 Longevity regulating pathway - multiple species
    118856865 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    118856865 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    118856865 (NRAS)
   05206 MicroRNAs in cancer
    118856865 (NRAS)
   05205 Proteoglycans in cancer
    118856865 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    118856865 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    118856865 (NRAS)
   05203 Viral carcinogenesis
    118856865 (NRAS)
   05230 Central carbon metabolism in cancer
    118856865 (NRAS)
   05231 Choline metabolism in cancer
    118856865 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    118856865 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    118856865 (NRAS)
   05225 Hepatocellular carcinoma
    118856865 (NRAS)
   05226 Gastric cancer
    118856865 (NRAS)
   05214 Glioma
    118856865 (NRAS)
   05216 Thyroid cancer
    118856865 (NRAS)
   05221 Acute myeloid leukemia
    118856865 (NRAS)
   05220 Chronic myeloid leukemia
    118856865 (NRAS)
   05218 Melanoma
    118856865 (NRAS)
   05211 Renal cell carcinoma
    118856865 (NRAS)
   05219 Bladder cancer
    118856865 (NRAS)
   05215 Prostate cancer
    118856865 (NRAS)
   05213 Endometrial cancer
    118856865 (NRAS)
   05224 Breast cancer
    118856865 (NRAS)
   05223 Non-small cell lung cancer
    118856865 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    118856865 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    118856865 (NRAS)
   05161 Hepatitis B
    118856865 (NRAS)
   05160 Hepatitis C
    118856865 (NRAS)
   05163 Human cytomegalovirus infection
    118856865 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    118856865 (NRAS)
   05165 Human papillomavirus infection
    118856865 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    118856865 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    118856865 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    118856865 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    118856865 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    118856865 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    118856865 (NRAS)
   01522 Endocrine resistance
    118856865 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tvp04131]
    118856865 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tvp04147]
    118856865 (NRAS)
   04031 GTP-binding proteins [BR:tvp04031]
    118856865 (NRAS)
Membrane trafficking [BR:tvp04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    118856865 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    118856865 (NRAS)
Exosome [BR:tvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   118856865 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   118856865 (NRAS)
  Exosomal proteins of breast cancer cells
   118856865 (NRAS)
  Exosomal proteins of colorectal cancer cells
   118856865 (NRAS)
GTP-binding proteins [BR:tvp04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    118856865 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 118856865
NCBI-ProteinID: XP_036623287
LinkDB
Position
7:54879510..54888345
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGAQG
CLGLSCAVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaccgagtacaaactggtggtggtcggagctggcggtgtggggaaaagcgccttgacc
atccagctcatccagaaccacttcgtagacgagtatgatcccacgatagaggactcgtat
cgaaagcaagtggttattgatggtgagacctgtttgttggacatactcgacacagctgga
caagaagagtacagtgccatgagagaccagtatatgaggacgggtgaaggctttctctgt
gtctttgccatcaacaatagcaagtcgtttgcagatattaacctttacagggaacaaatt
aaacgagtgaaagactcagatgatgtacctatggtgctggtgggaaataagtgtgatttg
ccgacaaggacagttgacacaaaacaggctcatgaactagccaagagctatggaattcct
ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta
agagaaatacggcagtaccgcatgaaaaaactcaacagcagcgacgacggggctcaaggc
tgtctgggtctttcatgtgcagtcatgtaa

DBGET integrated database retrieval system