Thioalkalivibrio versutus: TVD_00390 Help Entry TVD_00390         CDS       T03959                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tvr  Thioalkalivibrio versutus Pathway tvr01100   Metabolic pathways tvr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tvr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TVD_00390    00074 Mycolic acid biosynthesis     TVD_00390   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TVD_00390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AKJ93912 UniProt:  A0A0G3G314 LinkDB All DBs Position 80282..80533 Genome browser AA seq 83 aa AA seqDB search MSTLDHTKNLLDSALSLNGRAQHFDRKTTLLGGVPELDSMAVVSLITSIESHFDIVIDDD DVSAETFETLGTLVDFIDSKLDS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtcgaccctcgatcacaccaagaacctgctggacagtgccctgagtctgaacgggaga gcgcagcacttcgatcgcaagaccacgctgttgggtggcgtaccggagctggactcgatg gcggtcgtttcgctgatcacctcgatcgagagccatttcgacatcgtgatcgatgatgac gatgtcagtgccgagaccttcgagacgctcggcactctggtcgatttcatcgactccaag ctcgacagctag

DBGET integrated database retrieval system